Recombinant Full Length Gibberella Zeae Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged
Cat.No. : | RFL25185GF |
Product Overview : | Recombinant Full Length Gibberella zeae Mitochondrial import inner membrane translocase subunit TIM50(TIM50) Protein (Q4I099) (46-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gibberella zeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (46-525) |
Form : | Lyophilized powder |
AA Sequence : | SKRSSGQPPKESKKKPSQAQNDAEAAKTPEKPAENDVNKASEQSPEAPKEGEQIPFHKLP DLTQGIPSTLFEEMGGDKKKEQQALQELEEAESKGNERDRSEYVSTSERNRKWWTRFMLT AVAAGGTLSLLYMGRNWEDTIEAERHSDSPNGPSPSLWWKRAKARMTESVTYYQEPAFEK LLPDPDPTFERPYTLCLSLDDLLIHSEWTREHGWRIAKRPGVDYFIRYLSQYYELVLFTT TPYATGEPVMRKLDPFRLILWPLYREATKFEDGEIVKDLSYLNRDLSKVIIIDTKAKHVR NQPDNAIILDPWKGDKDDKNLVNLIPFLEYIHTMQYSDVRKVIKSFDGKDIPTEFARREA IARKEFQAKQLTHKHKHGSGVGALGNMLGLKPSNMNMMVSPDGEQNPAEAFAQGKMLQDV ARERGQRNYMELEKQIRENGEKWLKEEAAMMEAAQKEAMNSMMGSFGGWFGGNNPPEKKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TIM50 |
Synonyms | TIM50; FGRRES_09359; FGSG_09359; Mitochondrial import inner membrane translocase subunit TIM50 |
UniProt ID | Q4I099 |
◆ Recombinant Proteins | ||
RILP-2303H | Recombinant Human RILP protein, His-tagged | +Inquiry |
DUSP28-4888M | Recombinant Mouse DUSP28 Protein | +Inquiry |
AK4-241R | Recombinant Rat AK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL894AF | Recombinant Full Length Chlorella Protothecoides Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
RFL27469SF | Recombinant Full Length Schizosaccharomyces Pombe Protein Rer1(Rer1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
HB-42P | Native Pig Hemoglobin (HB) Protein | +Inquiry |
CALM3-74B | Native Bovine Calmodulin | +Inquiry |
Mb-160M | Native Mouse Mb | +Inquiry |
IgG-117P | Native Porcine Immunoglobulin G | +Inquiry |
◆ Cell & Tissue Lysates | ||
HeLa-232H | Human HeLa Membrane Lysate | +Inquiry |
ZNF501-62HCL | Recombinant Human ZNF501 293 Cell Lysate | +Inquiry |
PSMB9-2766HCL | Recombinant Human PSMB9 293 Cell Lysate | +Inquiry |
PSMD7-2745HCL | Recombinant Human PSMD7 293 Cell Lysate | +Inquiry |
HIST2H4A-5514HCL | Recombinant Human HIST2H4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIM50 Products
Required fields are marked with *
My Review for All TIM50 Products
Required fields are marked with *
0
Inquiry Basket