Recombinant Full Length Gibberella Zeae Gpi Mannosyltransferase 4(Smp3) Protein, His-Tagged
Cat.No. : | RFL12874GF |
Product Overview : | Recombinant Full Length Gibberella zeae GPI mannosyltransferase 4(SMP3) Protein (Q4I785) (1-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gibberella zeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-492) |
Form : | Lyophilized powder |
AA Sequence : | MWRRTYLTLVLIRLWFALSPSYLHPDENFQGPEVIAGQIFSYPVRHTWEFTSENPIRSVF PLWPVYGLPMLLLRWLWIGNGQDGEIPPIAVFWTLRVLMFAISFVLEDWALHELIPSPKH RRVAVLLVASSYVTWTYQTHTFSNSVETLVVAWSLVLIQRVADPRCLVYSTESHFQRFLS SQAFDCFQYSGKAAAVTTVIAIGLDTAFYLPDSVTWTDLIHRPVITPLNNFKYNSATENL AQHGLHPWYQHLVGNLPLLLGPAAALLVIRPKLSIRLWSAMSGLVVLSAFQHQEARFLLP TVPLFLSSIRMPRNQTVFYIFTAVWIGFNLALGSLMGIYHQGGVVPGQVFLSQQPDATQA IWWKTYTPPIWLLNGKNEFLTTRDVMGLKGELLLEQLSQLATCDTPADRRNQEYLKEKNG TYLIAPASATWLDPYLSNKGLEGLRFREVWRYRKHLNLDDLDFGDDGVWDTLARVIGRRG LVAWRVTKSCPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SMP3 |
Synonyms | SMP3; FGRRES_16739; FGSG_06923; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV |
UniProt ID | Q4I785 |
◆ Recombinant Proteins | ||
REPA-0107S | Recombinant Staphylococcus aureus (strain: TY825) REPA protein, His-tagged | +Inquiry |
AP1M1-596M | Recombinant Mouse AP1M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZNF816-ZNF321P-1828H | Recombinant Human ZNF816-ZNF321P | +Inquiry |
RFL34037HF | Recombinant Full Length Human Peroxisomal Membrane Protein 11A(Pex11A) Protein, His-Tagged | +Inquiry |
MLLT1-4626H | Recombinant Human MLLT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
TNNT2-4655H | Native Human Troponin T Type 2 (Cardiac) | +Inquiry |
CPA-01B | Native Bovine Pancreas Carboxypeptidase A, Type II-PMSF treated | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
C1-95H | Active Native Human C1 Complex | +Inquiry |
Serpinc1-5483R | Native Rat Serpin Peptidase Inhibitor, Clade C (antithrombin), Member 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAND1-7869HCL | Recombinant Human CAND1 293 Cell Lysate | +Inquiry |
LCMT2-4802HCL | Recombinant Human LCMT2 293 Cell Lysate | +Inquiry |
RNH1-2265HCL | Recombinant Human RNH1 293 Cell Lysate | +Inquiry |
PKDCC-1025HCL | Recombinant Human PKDCC cell lysate | +Inquiry |
TRAK1-813HCL | Recombinant Human TRAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SMP3 Products
Required fields are marked with *
My Review for All SMP3 Products
Required fields are marked with *
0
Inquiry Basket