Recombinant Full Length Bacillus Thuringiensis Subsp. Konkukian Thiol-Disulfide Oxidoreductase Resa(Resa) Protein, His-Tagged
Cat.No. : | RFL25235BF |
Product Overview : | Recombinant Full Length Bacillus thuringiensis subsp. konkukian Thiol-disulfide oxidoreductase resA(resA) Protein (Q6HL81) (1-173aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus thuringiensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-173) |
Form : | Lyophilized powder |
AA Sequence : | MKKNRLLFRVIILLILCGAVGFTLYQGYFTKEEKMEIGKEAPNFVVTDLEGKKIELKDFK GKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADETDIAVKNFVKQYDLKF PVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQTKEQLEEYLKKITP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | resA |
Synonyms | resA; BT9727_1356; Thiol-disulfide oxidoreductase ResA |
UniProt ID | Q6HL81 |
◆ Recombinant Proteins | ||
MARC1-1581H | Recombinant Human MARC1 protein, His & T7-tagged | +Inquiry |
AK4-2606H | Recombinant Human AK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Bco1-1852M | Recombinant Mouse Bco1 Protein, Myc/DDK-tagged | +Inquiry |
KIAA1429-2218R | Recombinant Rhesus Macaque KIAA1429 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRB1-3295R | Recombinant Rat KLRB1 Protein | +Inquiry |
◆ Native Proteins | ||
FGG -47P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
α-Crystallin-01B | Native Bovine α-Crystallin Protein | +Inquiry |
HP-145M | Native Mouse Hemoglobin | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSCL2-8402HCL | Recombinant Human BSCL2 293 Cell Lysate | +Inquiry |
ATF5-8629HCL | Recombinant Human ATF5 293 Cell Lysate | +Inquiry |
NCOA4-3940HCL | Recombinant Human NCOA4 293 Cell Lysate | +Inquiry |
AIFM3-8952HCL | Recombinant Human AIFM3 293 Cell Lysate | +Inquiry |
ACE2-3100HCL | Recombinant Human ACE2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All resA Products
Required fields are marked with *
My Review for All resA Products
Required fields are marked with *
0
Inquiry Basket