Recombinant Full Length Geobacillus Stearothermophilus Pts System Glucose-Specific Eiicba Component(Ptsg) Protein, His-Tagged
Cat.No. : | RFL9804GF |
Product Overview : | Recombinant Full Length Geobacillus stearothermophilus PTS system glucose-specific EIICBA component(ptsG) Protein (P42015) (1-324aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacillus Stearothermophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-324) |
Form : | Lyophilized powder |
AA Sequence : | HLLNVKIGMTFSGGVIDFLLFGVLPNRTAWWLVIPVGLVFAVIYYFGFRFAIRKWDLATP GREKTVEEAPKAEAAAAGDLPYEVLAALGGKENIEHLDACITRLRVSVHDIGRVDKDRLK ALGAAGVLEVGNNVQAIFGPKSDMLKGQIQDIMQGKAPARAEEKPKTAASEAAESETIAS PMSGEIVPLAEVPDQVFSQKMMGDGFAVMPTDGTVVSPVDGKIINVFPTKHAIGIQSAGG HEILIHVGIDTVKLNGQGFEALVKEGDEVKKGQPILRVDLDYVKQNAPSIVTPVIFTNLQ AGETVHVNKQGPVARGEDAVVTIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ptsG |
Synonyms | ptsG; PTS system glucose-specific EIICBA component; EII-Glc/EIII-Glc; EIICBA-Glc; EIICBA-Glc 1 [Includes: Glucose permease IIC component; PTS system glucose-specific EIIC component; Glucose-specific phosphotransferase enzyme IIB component; PTS system gluc |
UniProt ID | P42015 |
◆ Recombinant Proteins | ||
LRRC61-3839Z | Recombinant Zebrafish LRRC61 | +Inquiry |
WDR76-18502M | Recombinant Mouse WDR76 Protein | +Inquiry |
SCN1A-3533H | Recombinant Human SCN1A protein, His&Myc-tagged | +Inquiry |
SMAD1-4145R | Recombinant Rhesus Macaque SMAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABCC5-050H | Recombinant Human ABCC5 Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
IgA-3882M | Native Monkey Immunoglobulin A, Tag Free | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
LDH1-218H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPP38-555HCL | Recombinant Human RPP38 lysate | +Inquiry |
FLOT1-6186HCL | Recombinant Human FLOT1 293 Cell Lysate | +Inquiry |
GFPT2-5952HCL | Recombinant Human GFPT2 293 Cell Lysate | +Inquiry |
SCYL2-1574HCL | Recombinant Human SCYL2 cell lysate | +Inquiry |
CAMK2G-7877HCL | Recombinant Human CAMK2G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ptsG Products
Required fields are marked with *
My Review for All ptsG Products
Required fields are marked with *
0
Inquiry Basket