Recombinant Full Length Geobacillus Kaustophilus Upf0295 Protein Gk0479(Gk0479) Protein, His-Tagged
Cat.No. : | RFL538GF |
Product Overview : | Recombinant Full Length Geobacillus kaustophilus UPF0295 protein GK0479(GK0479) Protein (Q5L2R6) (1-117aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacillus kaustophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-117) |
Form : | Lyophilized powder |
AA Sequence : | MSIKYSSKINKIRTFALSLIFIGVIVMYLGLFFRTSPVIMTLFMLFGMLFLVASGIVYFW IGTLSTRAVQVVCPSCGKVTKMLGRVDLCMFCREPLTLDRELEGKEFDEKYNKKRKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GK0479 |
Synonyms | GK0479; UPF0295 protein GK0479 |
UniProt ID | Q5L2R6 |
◆ Native Proteins | ||
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
LDHC-28045TH | Native Human LDHC | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Tonsilla Cerebelli-74H | Human Tonsilla Cerebelli Tissue Lysate | +Inquiry |
GTF2I-763HCL | Recombinant Human GTF2I cell lysate | +Inquiry |
NR2C2-3713HCL | Recombinant Human NR2C2 293 Cell Lysate | +Inquiry |
STK17B-1407HCL | Recombinant Human STK17B 293 Cell Lysate | +Inquiry |
PMFBP1-1382HCL | Recombinant Human PMFBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GK0479 Products
Required fields are marked with *
My Review for All GK0479 Products
Required fields are marked with *
0
Inquiry Basket