Recombinant Full Length Human LMO4 Protein, C-Flag-tagged

• Cat.No.: LMO4-772HFL
• Product Overview: Recombinant Full Length Human LMO4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 17.8 kDa
• AA Sequence: MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGM ILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHD
  RPTALINGHLNSLQSNPLLPDQKVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transcription Factors
• Full Length: Full L.

Gene Information

• Gene Name: LMO4 LIM domain only 4 [ Homo sapiens (human) ]
• Official Symbol: LMO4
• Synonyms: LIM domain only 4; OTTHUMP00000011905; OTTHUMP00000011906
• Gene ID: 8543
• mRNA Refseq: NM_006769.4
• Protein Refseq: NP_006760.1
• MIM: 603129
• UniProt ID: P61968