Recombinant Full Length Gecko Japonicus Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 2(Ergic2) Protein, His-Tagged
Cat.No. : | RFL16723HF |
Product Overview : | Recombinant Full Length Gecko japonicus Endoplasmic reticulum-Golgi intermediate compartment protein 2(ERGIC2) Protein (Q5EHU7) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MRRLNRKKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWM KYEYEVDKDFSSKLRINIDITVAMKCQYVGADVLDLAETMVASTDGLVYEPAIFDLSPQQ KEWQRMLQRIQSRLQEEHSLQDVIFKSTFKSASTALPPREDDSSQPPDACRIHGHLYVNK VAGNFHITVGKAIPHPRGHAHLAALVNHDSYNFSHRIDHLSFGELVPGIINPLDGTEKIA LDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERVINHAAGSHGVSGIFMKYDLSSL MVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIIYCRFRLGAYKPVNSVPY EDGHTDNHLPLLENNTH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gecko japonicus Endoplasmic reticulum-Golgi intermediate compartment protein 2(ERGIC2) |
UniProt ID | Q5EHU7 |
◆ Recombinant Proteins | ||
EGFR-297H | Recombinant Human EGFR, GST-tagged, Active | +Inquiry |
MACROD2-5233H | Recombinant Human MACROD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIG4-5960Z | Recombinant Zebrafish LIG4 | +Inquiry |
GEMIN8-6304M | Recombinant Mouse GEMIN8 Protein | +Inquiry |
BCAS2-126H | Recombinant Human BCAS2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
C1-95H | Active Native Human C1 Complex | +Inquiry |
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMEM100-1018HCL | Recombinant Human TMEM100 293 Cell Lysate | +Inquiry |
GABRG3-6056HCL | Recombinant Human GABRG3 293 Cell Lysate | +Inquiry |
SOS1-1568HCL | Recombinant Human SOS1 293 Cell Lysate | +Inquiry |
CD274-2735HCL | Recombinant Human CD274 cell lysate | +Inquiry |
CLEC6A-2600MCL | Recombinant Mouse CLEC6A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gecko japonicus Endoplasmic reticulum-Golgi intermediate compartment protein 2(ERGIC2) Products
Required fields are marked with *
My Review for All Gecko japonicus Endoplasmic reticulum-Golgi intermediate compartment protein 2(ERGIC2) Products
Required fields are marked with *
0
Inquiry Basket