Recombinant Full Length Gecko Gecko Green-Sensitive Opsin P521 Protein, His-Tagged
Cat.No. : | RFL5110GF |
Product Overview : | Recombinant Full Length Gecko gecko Green-sensitive opsin P521 Protein (P35358) (1-365aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gekko gecko (Tokay gecko) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-365) |
Form : | Lyophilized powder |
AA Sequence : | MTEAWNVAVFAARRSRDDDDTTRGSVFTYTNTNNTRGPFEGPNYHIAPRWVYNLVSFFMI IVVIASCFTNGLVLVATAKFKKLRHPLNWILVNLAFVDLVETLVASTISVFNQIFGYFIL GHPLCVIEGYVVSSCGITGLWSLAIISWERWFVVCKPFGNIKFDSKLAIIGIVFSWVWAW GWSAPPIFGWSRYWPHGLKTSCGPDVFSGSVELGCQSFMLTLMITCCFLPLFIIIVCYLQ VWMAIRAVAAQQKESESTQKAEREVSRMVVVMIVAFCICWGPYASFVSFAAANPGYAFHP LAAALPAYFAKSATIYNPVIYVFMNRQFRNCIMQLFGKKVDDGSEASTTSRTEVSSVSNS SVAPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gecko gecko Green-sensitive opsin P521 |
Synonyms | Green-sensitive opsin P521; Green photoreceptor pigment |
UniProt ID | P35358 |
◆ Recombinant Proteins | ||
GABPB1-4633H | Recombinant Human GABPB1 Protein, GST-tagged | +Inquiry |
GART-6212M | Recombinant Mouse GART Protein | +Inquiry |
HISE-1358S | Recombinant Streptomyces coelicolor A3(2) HISE protein, His-tagged | +Inquiry |
DOK3-1447H | Recombinant Human DOK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFRSF14-30480TH | Recombinant Human TNFRSF14, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1852U | Active Native Ulex Europaeus Agglutinin I Protein, DyLight 649 labeled | +Inquiry |
KLK3-386H | Native Human Prostate Specific Antigen | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
PF4-253H | Native Human Platelet Factor 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SORCS3-1670HCL | Recombinant Human SORCS3 cell lysate | +Inquiry |
HRH1-5392HCL | Recombinant Human HRH1 293 Cell Lysate | +Inquiry |
JAG1-2382HCL | Recombinant Human JAG1 cell lysate | +Inquiry |
TMEM123-1790HCL | Recombinant Human TMEM123 cell lysate | +Inquiry |
CA3-7914HCL | Recombinant Human CA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gecko gecko Green-sensitive opsin P521 Products
Required fields are marked with *
My Review for All Gecko gecko Green-sensitive opsin P521 Products
Required fields are marked with *
0
Inquiry Basket