Recombinant Full Length Gallid Herpesvirus 2 38 Kda Phosphoprotein(Pp38) Protein, His-Tagged
Cat.No. : | RFL3132GF |
Product Overview : | Recombinant Full Length Gallid herpesvirus 2 38 kDa phosphoprotein(PP38) Protein (P68348) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gallid herpesvirus 2 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MEFEAEHEGLTASWVAPAPQGGKGAEGRAGVADEAGHGKTEAECAEDGEKCGDAEMSALD RVQRDRWRFSSPPPHSGVTGKGAIPIKGDGKAIECQELTGEGEWLSQWEELPPEPRRSGN EHLDESRYAKQTERGSSTGKEEGDGMKQMGELAQQCEGGTYADLLVEAEQAVVHSVRALM LAERQNPNILGEHLNKKRVLVQRPRTILSVESENATMRSYMLVTLICSAKSLLLGSCMSF FAGMLVGRTADVKTPLWDTVCLLMAFCAGIVVGGVDSGEVESGETKSESN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PP38 |
Synonyms | PP38; 38 kDa phosphoprotein; Phosphoprotein pp38 |
UniProt ID | P68348 |
◆ Native Proteins | ||
GG-192M | Native Mouse Gamma Globulin protein | +Inquiry |
Proteasome 19S-39H | Native Human Proteasome 19S Protein, Tag Free | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
CII-250C | Native Chicken CII | +Inquiry |
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
OVOL1-1263HCL | Recombinant Human OVOL1 cell lysate | +Inquiry |
DUSP5-6772HCL | Recombinant Human DUSP5 293 Cell Lysate | +Inquiry |
MEP1A-2510MCL | Recombinant Mouse MEP1A cell lysate | +Inquiry |
DUS4L-6787HCL | Recombinant Human DUS4L 293 Cell Lysate | +Inquiry |
KDM4D-4993HCL | Recombinant Human KDM4D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PP38 Products
Required fields are marked with *
My Review for All PP38 Products
Required fields are marked with *
0
Inquiry Basket