Recombinant Full Length Frankia Sp. Undecaprenyl-Diphosphatase 1(Uppp1) Protein, His-Tagged
Cat.No. : | RFL32077FF |
Product Overview : | Recombinant Full Length Frankia sp. Undecaprenyl-diphosphatase 1(uppP1) Protein (Q2JAC3) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Frankia casuarinae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MSSFSYAEAGVIGALQGATELFPVSSLGHSVLVPALIGGRWAADLDVSAPESPYLAFIVA VHVATAAALIVAFRDDWRRIITGLAVSVRDRRVTTADGRLAWLIILGTVPVGIVGLLLEH PLRTHLGRPLPAAVFLTVNGMIMLLGERLRRRSTTRGAPGPAGYRDEHTMPIPRSAPVTG RRVGTRPASGPLVAHGSAPGSGPGNHSKAVTTETALPEAEDVTLPEAETALPEAETAARH ADRRLAALPRLDALLVGVAQTAALAPGISRSGVTMIAGLSRGLSHLDAARFAFLLATPVI LAAGLLKLPDLLGPLGDGVRGQTLFGAIVAGVVAYVSIRFLARWFETRTATPFAVYCLVA GALCVVRFGIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP1 |
Synonyms | uppP1; Francci3_2402; Undecaprenyl-diphosphatase 1; Bacitracin resistance protein 1; Undecaprenyl pyrophosphate phosphatase 1 |
UniProt ID | Q2JAC3 |
◆ Recombinant Proteins | ||
GAS7-5457HF | Recombinant Full Length Human GAS7 Protein, GST-tagged | +Inquiry |
ERGIC2-495C | Recombinant Cynomolgus ERGIC2 Protein, His-tagged | +Inquiry |
SLC39A13-1399Z | Recombinant Zebrafish SLC39A13 | +Inquiry |
RFL8079DF | Recombinant Full Length Danio Rerio Heme Transporter Hrg1-B(Slc48A1A) Protein, His-Tagged | +Inquiry |
KLRC1-644C | Recombinant Cynomolgus KLRC1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VCL-899T | Native Turkey VCL Protein | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
Collagen-48H | Native Human Collagen V | +Inquiry |
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
IgA-239S | Native Sheep Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLN6-7438HCL | Recombinant Human CLN6 293 Cell Lysate | +Inquiry |
PTS-2668HCL | Recombinant Human PTS 293 Cell Lysate | +Inquiry |
CSAD-7252HCL | Recombinant Human CSAD 293 Cell Lysate | +Inquiry |
PON2-3013HCL | Recombinant Human PON2 293 Cell Lysate | +Inquiry |
Epididymis-639B | Bovine Epididymis Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP1 Products
Required fields are marked with *
My Review for All uppP1 Products
Required fields are marked with *
0
Inquiry Basket