Recombinant Full Length Faba Bean Necrotic Yellows Virus Putative Movement Protein(Dna-M) Protein, His-Tagged
Cat.No. : | RFL15969FF |
Product Overview : | Recombinant Full Length Faba bean necrotic yellows virus Putative movement protein(DNA-M) Protein (Q9WIJ7) (1-114aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Faba bean necrotic yellows virus (isolate Egyptian EV1-93) (FBNYV) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-114) |
Form : | Lyophilized powder |
AA Sequence : | MADTGYYAGYQDDVDVDEQKRHQALYLIGIILLVTVCLTVLWVCIMLACYVPGFLKKTLE AWLNSSSLMKRRVASTLTRTPFEATGPERERNWEARRQSTTVNPASQPNTGSVF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DNA-M |
Synonyms | DNA-M; C4; Putative movement protein; MP |
UniProt ID | Q9WIJ7 |
◆ Recombinant Proteins | ||
FOXD3-1563R | Recombinant Rhesus Macaque FOXD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAMP2-5886H | Recombinant Human LAMP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HGF-290H | Active Recombinant Human HGF | +Inquiry |
CDHR1A-1415Z | Recombinant Zebrafish CDHR1A | +Inquiry |
SSBA-0428B | Recombinant Bacillus subtilis SSBA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP-175C | Native Guinea Pig Fatty acid Binding Protein | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
LukAB-733S | Native S. aureus LukA-LukB heterodimer Protein | +Inquiry |
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-B-5495HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
ACTL6A-9061HCL | Recombinant Human ACTL6A 293 Cell Lysate | +Inquiry |
Amygdala-14H | Human Amygdala (Alzheimers Disease) Lysate | +Inquiry |
CTLA4-2179MCL | Recombinant Mouse CTLA4 cell lysate | +Inquiry |
EVI2A-001HCL | Recombinant Human EVI2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNA-M Products
Required fields are marked with *
My Review for All DNA-M Products
Required fields are marked with *
0
Inquiry Basket