Recombinant Full Length Exeristes Roborator Cytochrome C Oxidase Subunit 2(Coii) Protein, His-Tagged
Cat.No. : | RFL28589EF |
Product Overview : | Recombinant Full Length Exeristes roborator Cytochrome c oxidase subunit 2(COII) Protein (P29873) (1-224aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Exeristes roborator (Parasitoid wasp) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-224) |
Form : | Lyophilized powder |
AA Sequence : | MSTWSMMNLQDANSPMMEQLIFFHDHTLMILLLITITIIYIISSIIMNNLTNKFIMQNQT IEIIWTIIPMIILIYMAIPSLKILYLNDEINNPLMTIKSIGHQWYWSYEYSDFKNIDFNS FMINSKNLNHFRLLDVDNRMIIPMNNQIRMLINSADVIHSWTVPSLGVKIDSVPGRINQT LMMINRPGIYFGQCSEICGMNHSFMPIVIESTSNNNFISWLKSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COII |
Synonyms | COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | P29873 |
◆ Recombinant Proteins | ||
RXRG-6846C | Recombinant Chicken RXRG | +Inquiry |
FAM120A-1129H | Recombinant Human FAM120A Protein, MYC/DDK-tagged | +Inquiry |
FLT1-241H | Active Recombinant Human FLT1, Fc Chimera | +Inquiry |
SUMF2-1505Z | Recombinant Zebrafish SUMF2 | +Inquiry |
CXCL9-167H | Recombinant Human X-C motif chemokine ligand 9 Protein, Tag Free | +Inquiry |
◆ Native Proteins | ||
Bilirubin-156P | Native Porcine Bilirubin | +Inquiry |
Lectin-1787G | Active Native Griffonia Simplicifolia Lectin II Protein, Agarose bound | +Inquiry |
APCS-31189TH | Native Human APCS | +Inquiry |
Proc-5346M | Native Mouse Protein C | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NHLRC2-1193HCL | Recombinant Human NHLRC2 cell lysate | +Inquiry |
Flaxseed-693P | Flaxseed Lysate, Total Protein | +Inquiry |
MLANA-411HCL | Recombinant Human MLANA lysate | +Inquiry |
LRCH4-4658HCL | Recombinant Human LRCH4 293 Cell Lysate | +Inquiry |
CCDC126-7783HCL | Recombinant Human CCDC126 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All COII Products
Required fields are marked with *
My Review for All COII Products
Required fields are marked with *
0
Inquiry Basket