Recombinant Full Length Locusta Migratoria Cytochrome C Oxidase Subunit 2(Coii) Protein, His-Tagged
Cat.No. : | RFL8626LF |
Product Overview : | Recombinant Full Length Locusta migratoria Cytochrome c oxidase subunit 2(COII) Protein (P14573) (1-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Locusta migratoria (Migratory locust) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-227) |
Form : | Lyophilized powder |
AA Sequence : | MATWSNLSLQDGASPLMEQLSFFHDHTMIDLLLITMIVGYSLSYMLLTKYTNRNMLHGHL IETIWTALPAITLIFIALPSLRLLYLLDDSSDAMITIKTIGRQWYWSYEYSDFINVEFDT YMTPENELNTDEFRLLEVDNRTTLPMNTEVRVLTSASDVLHSWAVPALVLKIDATPGRLN QGMFMINRPGLFFGQCSEICGANHSFMPIVIESTSIKLFIKWLSNMM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COII |
Synonyms | COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II |
UniProt ID | P14573 |
◆ Native Proteins | ||
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR4-829HCL | Recombinant Human HTR4 cell lysate | +Inquiry |
C11orf24-74HCL | Recombinant Human C11orf24 lysate | +Inquiry |
PAQR9-1282HCL | Recombinant Human PAQR9 cell lysate | +Inquiry |
CD86-2598MCL | Recombinant Mouse CD86 cell lysate | +Inquiry |
ROBO2-1225HCL | Recombinant Human ROBO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All COII Products
Required fields are marked with *
My Review for All COII Products
Required fields are marked with *
0
Inquiry Basket