Recombinant Full Length Esx-4 Secretion System Protein Eccb4(Eccb4) Protein, His-Tagged
Cat.No. : | RFL197HF |
Product Overview : | Recombinant Full Length ESX-4 secretion system protein eccB4(eccB4) Protein (O06317) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MPSPATTWLHVSGYRFLLRRIECALLFGDVCAATGALRARTTSLALGCVLAIVAAMGCAF VALLRPQSALGQAPIVMGRESGALYVRVDDVWHPVLNLASARLIAATNANPQPVSESELG HTKRGPLLGIPGAPQLLDQPLAGAESAWAICDSDNGGSTTVVVGPAEDSSAQVLTAEQMI LVATESGSPTYLLYGGRRAVVDLADPAVVWALRLQGRVPHVVAQSLLNAVPEAPRITAPR IRGGGRASVGLPGFLVGGVVRITRASGDEYYVVLEDGVQRIGQVAADLLRFGDSQGSVNV PTVAPDVIRVAPIVNTLPVSAFPDRPPTPVDGSPGRAVTTLCVTWTPAQPGAARVAFLAG SGPPVPLGGVPVTLAQADGRGPALDAVYLPPGRSAYVAARSLSGGGTGTRYLVTDTGVRF AIHDDDVAHDLGLPTAAIPAPWPVLATLPSGPELSRANASVARDTVAPGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESX-4 secretion system protein eccB4(eccB4) |
UniProt ID | O06317 |
◆ Native Proteins | ||
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
LDL-407H | Native Human Low Density Lipoprotein, Acetylated, DiI labeled | +Inquiry |
PLD-19S | Active Native Streptomyces sp. Phospholipase D, Type VII | +Inquiry |
PeptideD-724E | Native Ebola virus Delta Peptide | +Inquiry |
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGTR1-8970HCL | Recombinant Human AGTR1 293 Cell Lysate | +Inquiry |
GNA14-721HCL | Recombinant Human GNA14 cell lysate | +Inquiry |
CXCL16-2545MCL | Recombinant Mouse CXCL16 cell lysate | +Inquiry |
TPM3-842HCL | Recombinant Human TPM3 293 Cell Lysate | +Inquiry |
VPS45-384HCL | Recombinant Human VPS45 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ESX-4 secretion system protein eccB4(eccB4) Products
Required fields are marked with *
My Review for All ESX-4 secretion system protein eccB4(eccB4) Products
Required fields are marked with *
0
Inquiry Basket