Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL8189EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (B1ISR9) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; EcolC_2283; Zinc transport protein ZntB |
UniProt ID | B1ISR9 |
◆ Recombinant Proteins | ||
PHF5A-12730M | Recombinant Mouse PHF5A Protein | +Inquiry |
MSA2-1602P | Recombinant Plasmodium Falciparum MSA2 Protein (109-246 aa), His-tagged | +Inquiry |
TPPP3-15873H | Recombinant Human TPPP3, His-tagged | +Inquiry |
Dph6-1780M | Recombinant Mouse Dph6 Protein, Myc/DDK-tagged | +Inquiry |
WRAP73-1444C | Recombinant Chicken WRAP73 | +Inquiry |
◆ Native Proteins | ||
COL3A1-17B | Native Bovine COL3A1 Protein | +Inquiry |
GCT-007H | Native Human Gamma glutamyl transferases Protein | +Inquiry |
IgG-05T | Native Toxoplasma gondii IgG antigen, RH strain | +Inquiry |
PLG -38C | Native Chicken plasmin | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFC-429HCL | Recombinant Human PDGFC cell lysate | +Inquiry |
TFPI-2746HCL | Recombinant Human TFPI cell lysate | +Inquiry |
KIFC2-933HCL | Recombinant Human KIFC2 cell lysate | +Inquiry |
NT5DC1-3674HCL | Recombinant Human NT5DC1 293 Cell Lysate | +Inquiry |
CTNS-7198HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket