Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL10307EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (B1XCH1) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; ECDH10B_1463; Zinc transport protein ZntB |
UniProt ID | B1XCH1 |
◆ Recombinant Proteins | ||
SMAD2-2040H | Recombinant Human SMAD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPO-363H | Active Recombinant Human EPO Protein, His-tagged | +Inquiry |
SNX17-4207R | Recombinant Rhesus Macaque SNX17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Asic3-3073R | Recombinant Rat Asic3, His-tagged | +Inquiry |
MT1A-1520H | Recombinant Human MT1A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
Bladder-023H | Human Bladder Lysate, Total Protein | +Inquiry |
ppk-8320P | Native Propionibacterium shermanii ppk | +Inquiry |
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SQRDL-1482HCL | Recombinant Human SQRDL 293 Cell Lysate | +Inquiry |
ATG4B-8624HCL | Recombinant Human ATG4B 293 Cell Lysate | +Inquiry |
ACSS1-19HCL | Recombinant Human ACSS1 cell lysate | +Inquiry |
GCNT1-5980HCL | Recombinant Human GCNT1 293 Cell Lysate | +Inquiry |
MRPS35-4135HCL | Recombinant Human MRPS35 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket