Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL28133EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (B7L5A9) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; EC55989_1507; Zinc transport protein ZntB |
UniProt ID | B7L5A9 |
◆ Recombinant Proteins | ||
POLR2J2-321H | Recombinant Human POLR2J2 Protein, His-tagged | +Inquiry |
SAP032A-012-4164S | Recombinant Staphylococcus aureus (strain: WBG8287, other: ST1-MRSA-IVa (2B)) SAP032A_012 protein, His-tagged | +Inquiry |
RFL26881SF | Recombinant Full Length Salmonella Heidelberg Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
FTSJD2-3385M | Recombinant Mouse FTSJD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENG-132H | Recombinant Human Endoglin | +Inquiry |
◆ Native Proteins | ||
FGB-6H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
MG-202H | Native Human Menopausal Gonadotropin | +Inquiry |
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP4-2925MCL | Recombinant Mouse IGFBP4 cell lysate | +Inquiry |
PPP6R3-2066HCL | Recombinant Human SAPS3 293 Cell Lysate | +Inquiry |
FAM82B-6345HCL | Recombinant Human FAM82B 293 Cell Lysate | +Inquiry |
Brain-44H | Hamster Brain Lysate | +Inquiry |
EL4-161H | EL4 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket