Recombinant Full Length Escherichia Coli Upf0716 Protein Fxsa(Fxsa) Protein, His-Tagged
Cat.No. : | RFL4968EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0716 protein fxsA(fxsA) Protein (P37147) (1-158aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-158) |
Form : | Lyophilized powder |
AA Sequence : | MRWLPFIAIFLYVYIEISIFIQVAHVLGVLLTLVLVIFTSVIGMSLVRNQGFKNFVLMQQ KMAAGENPAAEMIKSVSLIIAGLLLLLPGFFTDFLGLLLLLPPVQKHLTVKLMPHLRFSR MPGGGFSAGTGGGNTFDGEYQRKDDERDRLDHKDDRQD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fxsA |
Synonyms | fxsA; yjeG; b4140; JW4100; UPF0716 protein FxsA; Suppressor of F exclusion of phage T7 |
UniProt ID | P37147 |
◆ Native Proteins | ||
LTA-18S | Native S. aureus LTA Protein | +Inquiry |
IgG-118H | Native Horse Immunoglobulin G | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
KNG1-29338TH | Native Human KNG1 | +Inquiry |
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKM2-3152HCL | Recombinant Human PKM2 293 Cell Lysate | +Inquiry |
LARP6-971HCL | Recombinant Human LARP6 cell lysate | +Inquiry |
RIOK1-001HCL | Recombinant Human RIOK1 cell lysate | +Inquiry |
CCDC137-154HCL | Recombinant Human CCDC137 lysate | +Inquiry |
NRXN1-3690HCL | Recombinant Human NRXN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fxsA Products
Required fields are marked with *
My Review for All fxsA Products
Required fields are marked with *
0
Inquiry Basket