Recombinant Full Length Escherichia Coli Upf0266 Membrane Protein Yobd(Yobd) Protein, His-Tagged
Cat.No. : | RFL32734EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0266 membrane protein yobD(yobD) Protein (B1XH87) (1-152aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-152) |
Form : | Lyophilized powder |
AA Sequence : | MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLVSTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yobD |
Synonyms | yobD; ECDH10B_1958; UPF0266 membrane protein YobD |
UniProt ID | B1XH87 |
◆ Recombinant Proteins | ||
Cars-1967M | Recombinant Mouse Cars Protein, Myc/DDK-tagged | +Inquiry |
NRXN3-129H | Recombinant Human NRXN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CITED2-1559Z | Recombinant Zebrafish CITED2 | +Inquiry |
CTH-2052M | Recombinant Mouse CTH Protein, His (Fc)-Avi-tagged | +Inquiry |
TALB-2681E | Recombinant Escherichia coli TALB Protein (2-317 aa), His-Myc-tagged | +Inquiry |
◆ Native Proteins | ||
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
GOT-185H | Active Native Human Glutamate Oxaloacetate Tranasminase | +Inquiry |
CEase-21P | Active Native Porcine Cholesterol esterase | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNJ1-5049HCL | Recombinant Human KCNJ1 293 Cell Lysate | +Inquiry |
COMMD2-7371HCL | Recombinant Human COMMD2 293 Cell Lysate | +Inquiry |
RRP12-907HCL | Recombinant Human RRP12 cell lysate | +Inquiry |
MBNL3-1067HCL | Recombinant Human MBNL3 cell lysate | +Inquiry |
PC-12-015WCY | Rat adrenal pheochromocytoma PC-12 Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yobD Products
Required fields are marked with *
My Review for All yobD Products
Required fields are marked with *
0
Inquiry Basket