Recombinant Full Length Escherichia Coli Upf0053 Protein Yegh(Yegh) Protein, His-Tagged
Cat.No. : | RFL3490EF |
Product Overview : | Recombinant Full Length Escherichia coli UPF0053 protein yegH(yegH) Protein (P76389) (1-527aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-527) |
Form : | Lyophilized powder |
AA Sequence : | MEWIADPSIWAGLITLIVIELVLGIDNLVFIAILAEKLPPKQRDRARVTGLLLAMLMRLL LLASISWLVTLTQPLFSFRSFTFSARDLIMLFGGFFLLFKATMELNERLEGKDSNNPTQR KGAKFWGVVTQIVVLDAIFSLDSVITAVGMVDHLLVMMAAVVIAISLMLMASKPLTQFVN SHPTIVILCLSFLLMIGFSLVAEGFGFVIPKGYLYAAIGFSVMIEALNQLAIFNRRRFLS ANQTLRQRTTEAVMRLLSGQKEDAELDAETASMLVDHGNQQIFNPQERRMIERVLNLNQR TVSSIMTSRHDIEHIDLNAPEEEIRQLLERNQHTRLVVTDGDDAEDLLGVVHVIDLLQQS LRGEPLNLRVLIRQPLVFPETLPLLPALEQFRNARTHFAFVVDEFGSVEGIVTLSDVTET IAGNLPNEVEEIDARHDIQKNADGSWTANGHMPLEDLVQYVPLPLDEKREYHTIAGLLME YLQRIPKPGEEVQVGDYLLKTLQVESHRVQKVQIIPLRKDGEMEYEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yegH |
Synonyms | yegH; b2063; JW5336; UPF0053 protein YegH |
UniProt ID | P76389 |
◆ Native Proteins | ||
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
FBa-12H | Native Human Factor Ba protein | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
FTH1-28156TH | Native Human FTH1 | +Inquiry |
LDL-406H | Native Human Low Density Lipoprotein, Acetylated, Biotin labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBL3-1211HCL | Recombinant Human TBL3 293 Cell Lysate | +Inquiry |
HIST1H2BA-5543HCL | Recombinant Human HIST1H2BA 293 Cell Lysate | +Inquiry |
ADAR-9025HCL | Recombinant Human ADAR 293 Cell Lysate | +Inquiry |
ENPP5-1509HCL | Recombinant Human ENPP5 cell lysate | +Inquiry |
C5orf34-8013HCL | Recombinant Human C5orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yegH Products
Required fields are marked with *
My Review for All yegH Products
Required fields are marked with *
0
Inquiry Basket