Recombinant Full Length Escherichia Coli Uncharacterized Protein Ylab(Ylab) Protein, His-Tagged
Cat.No. : | RFL3794EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein YlaB(ylaB) Protein (P77473) (1-516aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-516) |
Form : | Lyophilized powder |
AA Sequence : | MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYSSRVAIRANKVATQGK DALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVAYIDNNVPQCSSLEHESPPDTFPEP GKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFIDVIPYSSWQIDAAIIGNA HNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPLPEMNISIITWASTKMLQKGWH RQVFIWLPLGLVIGLLAAMFVLRILRRIQSPHHRLQDAIENRDICVHYQPIVSLANGKIV GAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIRSVFEDMGDWLRQHPQQHISI NLESPVLTSEKIPQLLRDMINHYQVNPRQIALELTEREFADPKTSAPIISRYREAGHEIY LDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVTPHIIEMAKTLKLKMVAEGIETS KQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pdeB |
Synonyms | pdeB; ylaB; b0457; JW5062; Probable cyclic di-GMP phosphodiesterase PdeB |
UniProt ID | P77473 |
◆ Native Proteins | ||
ATF-181R | Native Rat Apotransferrin | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
LYPL-29 | Active Native Lysophospholipase | +Inquiry |
ALB-198B | Native Bovine ALB protein, methylated | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZDHHC11-1969HCL | Recombinant Human ZDHHC11 cell lysate | +Inquiry |
CYP11A1-7131HCL | Recombinant Human CYP11A1 293 Cell Lysate | +Inquiry |
Colon-810H | Hamster Colon Membrane Lysate, Total Protein | +Inquiry |
EFNA5-2156MCL | Recombinant Mouse EFNA5 cell lysate | +Inquiry |
PPIL3-2966HCL | Recombinant Human PPIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All pdeB Products
Required fields are marked with *
My Review for All pdeB Products
Required fields are marked with *
0
Inquiry Basket