Recombinant Full Length Escherichia Coli Uncharacterized Protein Yjin(Yjin) Protein, His-Tagged
Cat.No. : | RFL20196EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein yjiN(yjiN) Protein (P39385) (1-426aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-426) |
Form : | Lyophilized powder |
AA Sequence : | MNKLIELRRAKRLALSLLLIAAATFVVTLFLPPNFWVSGVKAIAEAAMVGALADWFAVVA LFRRVPIPIISRHTAIIPRNKDRIGENLGQFVQEKFLDTQSLVALIRRHEPALLIGNWFS QPENARRVGQHLLQIMSGFLELTDDARIQRLLKRAVHRAIDKVDLSGTSALMLESMTKND RHQVLLDTLIAQLIALLQRDKSRKFIAQQIVRWLESEHPLKAKILPTEWLGEHSAELVSD AVNSLLDDISRDRAHQIRHAFDRATFALIDKLKNDPEMAARADAVKSYLKEDEAFNRYLS ELWGDLREWLKVDINSEDSRVKERIARAGQWFGETLIADDALRASLNGHLEQAAHRVAPE FSAFLTRHISDTVKSWDARDMSRQIELNIGKDLQFIRVNGTLVGGCIGLILYLLSQLPAL FPLGNF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yjiN |
Synonyms | yjiN; b4336; JW4299; Uncharacterized protein YjiN |
UniProt ID | P39385 |
◆ Native Proteins | ||
LTF-8194H | Native Human Neutrophil Lactoferrin | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
◆ Cell & Tissue Lysates | ||
RRAS2-1544HCL | Recombinant Human RRAS2 cell lysate | +Inquiry |
EXOC7-6507HCL | Recombinant Human EXOC7 293 Cell Lysate | +Inquiry |
C22orf32-8091HCL | Recombinant Human C22orf32 293 Cell Lysate | +Inquiry |
POLR2J-3030HCL | Recombinant Human POLR2J 293 Cell Lysate | +Inquiry |
CDH17-1483RCL | Recombinant Rat CDH17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yjiN Products
Required fields are marked with *
My Review for All yjiN Products
Required fields are marked with *
0
Inquiry Basket