Recombinant Full Length Escherichia Coli Uncharacterized Protein Yhju(Yhju) Protein, His-Tagged
Cat.No. : | RFL19215EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein yhjU(yhjU) Protein (P37659) (1-559aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-559) |
Form : | Lyophilized powder |
AA Sequence : | MTQFTQNTAMPSSLWQYWRGLSGWNFYFLVKFGLLWAGYLNFHPLLNLVFAAFLLMPLPR YSLHRLRHWIALPIGFALFWHDTWLPGPESIMSQGSQVAGFSTDYLIDLVTRFINWQMIG AIFVLLVAWLFLSQWIRITVFVVAILLWLNVLTLAGPSFSLWPAGQPTTTVTTTGGNAAA TVAATGGAPVVGDMPAQTAPPTTANLNAWLNNFYNAEAKRKSTFPSSLPADAQPFELLVI NICSLSWSDIEAAGLMSHPLWSHFDIEFKNFNSATSYSGPAAIRLLRASCGQTSHTNLYQ PANNDCYLFDNLSKLGFTQHLMMGHNGQFGGFLKEVRENGGMQSELMDQTNLPVILLGFD GSPVYDDTAVLNRWLDVTEKDKNSRSATFYNTLPLHDGNHYPGVSKTADYKARAQKFFDE LDAFFTELEKSGRKVMVVVVPEHGGALKGDRMQVSGLRDIPSPSITDVPVGVKFFGMKAP HQGAPIVIEQPSSFLAISDLVVRVLDGKIFTEDNVDWKKLTSGLPQTAPVSENSNAVVIQ YQDKPYVRLNGGDWVPYPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bcsG |
Synonyms | bcsG; yhjU; b3538; JW3506; Cellulose biosynthesis protein BcsG |
UniProt ID | P37659 |
◆ Recombinant Proteins | ||
ACSM1-806HF | Recombinant Full Length Human ACSM1 Protein, GST-tagged | +Inquiry |
Tyro3-9799M | Recombinant Mouse Tyro3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RWDD2A-638C | Recombinant Cynomolgus Monkey RWDD2A Protein, His (Fc)-Avi-tagged | +Inquiry |
SEMA4D-155R | Recombinant Rhesus SEMA4D protein, His-tagged | +Inquiry |
GPATCH2-5140H | Recombinant Human GPATCH2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CVF-01I | Native purified cobra venom factor | +Inquiry |
IgG1-225H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
MB-01B | Native Bovine MB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC18-496HCL | Recombinant Human DNAJC18 cell lysate | +Inquiry |
ATP5G1-8600HCL | Recombinant Human ATP5G1 293 Cell Lysate | +Inquiry |
PRKCE-2857HCL | Recombinant Human PRKCE 293 Cell Lysate | +Inquiry |
ART4-1541MCL | Recombinant Mouse ART4 cell lysate | +Inquiry |
C8orf4-131HCL | Recombinant Human C8orf4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bcsG Products
Required fields are marked with *
My Review for All bcsG Products
Required fields are marked with *
0
Inquiry Basket