Recombinant Full Length Escherichia Coli Uncharacterized Protein Yfdy(Yfdy) Protein, His-Tagged
Cat.No. : | RFL25038EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein yfdY(yfdY) Protein (P76521) (1-80aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-80) |
Form : | Lyophilized powder |
AA Sequence : | MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIF MFLAPACGLMIRFMVGYGRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yfdY |
Synonyms | yfdY; b2377; JW2374; Uncharacterized protein YfdY |
UniProt ID | P76521 |
◆ Recombinant Proteins | ||
PLA2G16-3652HF | Recombinant Full Length Human PLA2G16 Protein, GST-tagged | +Inquiry |
ADAL-271H | Recombinant Human ADAL Protein, GST-tagged | +Inquiry |
KCNC4-7801Z | Recombinant Zebrafish KCNC4 | +Inquiry |
RFL3055DF | Recombinant Full Length Danio Rerio Transmembrane Protein 41A-A(Tmem41Aa) Protein, His-Tagged | +Inquiry |
PQLC2-2101Z | Recombinant Zebrafish PQLC2 | +Inquiry |
◆ Native Proteins | ||
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
FGA-34D | Native Canine Fibrinogen | +Inquiry |
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
TF-324H | Native Human Transferrin, Texas Red Label | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALK1-558HCL | Recombinant Human GALK1 cell lysate | +Inquiry |
LRRC10-4650HCL | Recombinant Human LRRC10 293 Cell Lysate | +Inquiry |
RETSAT-2415HCL | Recombinant Human RETSAT 293 Cell Lysate | +Inquiry |
HA-2339HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yfdY Products
Required fields are marked with *
My Review for All yfdY Products
Required fields are marked with *
0
Inquiry Basket