Recombinant Human ADAL Protein, GST-tagged

• Cat.No.: ADAL-271H
• Product Overview: Human ADAL full-length ORF ( NP_001012987.1, 1 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ADAL (Adenosine Deaminase Like) is a Protein Coding gene. Among its related pathways are Metabolism and Abacavir transport and metabolism. GO annotations related to this gene include adenosine deaminase activity and deaminase activity.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.4 kDa
• AA Sequence: MIEAEEQQPCKTDFYSELPKVELHAHLNGSISSHTMKKLIAQKPDLKIHDQMTVIDKGKKRTLEECFQMFQTIHQLTSSPEDILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQSKQENLDIDVRYLIAVDRRGGPLVAKETVKLAEEFFLSTEGTVLGLDLSGDPTVGQAKDFLEPLLEAKKAGLKLALHLSEIPNQKKETQILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLGKAWSFRSSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ADAL adenosine deaminase-like [ Homo sapiens ]
• Official Symbol: ADAL
• Synonyms: ADAL; adenosine deaminase-like; adenosine deaminase-like protein; FLJ44620; DKFZp313B2137
• Gene ID: 161823
• mRNA Refseq: NM_001012969
• Protein Refseq: NP_001012987
• UniProt ID: Q6DHV7