Recombinant Full Length Escherichia Coli Uncharacterized Protein Yaiz(Yaiz) Protein, His-Tagged
Cat.No. : | RFL9941EF |
Product Overview : | Recombinant Full Length Escherichia coli Uncharacterized protein yaiZ(yaiZ) Protein (P0AAQ0) (1-70aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-70) |
Form : | Lyophilized powder |
AA Sequence : | MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR RRDEETENAQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yaiZ |
Synonyms | yaiZ; b0380; JW5053; Uncharacterized protein YaiZ |
UniProt ID | P0AAQ0 |
◆ Native Proteins | ||
ALA-02B | Native Bovine α-Lactalbumin Protein | +Inquiry |
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
Collagen-44H | Native Human Collagen I | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Hela-02HL | HeLa Whole Cell Lysate | +Inquiry |
TM4SF5-1033HCL | Recombinant Human TM4SF5 293 Cell Lysate | +Inquiry |
CRLF2-7275HCL | Recombinant Human CRLF2 293 Cell Lysate | +Inquiry |
KRTAP20-1-4844HCL | Recombinant Human KRTAP20 293 Cell Lysate | +Inquiry |
CTTNBP2NL-7188HCL | Recombinant Human CTTNBP2NL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yaiZ Products
Required fields are marked with *
My Review for All yaiZ Products
Required fields are marked with *
0
Inquiry Basket