Recombinant Full Length Enterobacteria Phage I2-2 Virion Export Protein(Iv) Protein, His-Tagged
Cat.No. : | RFL32930EF |
Product Overview : | Recombinant Full Length Enterobacteria phage I2-2 Virion export protein(IV) Protein (P15420) (23-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Enterobacteria phage I2-2 (Bacteriophage I2-2) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-428) |
Form : | Lyophilized powder |
AA Sequence : | EPVTLNNSPVRSFVQWYSSKTGKSVIVNPDVKGNITVFNADVNNANIDDFFKSVLNANGL VVVAGNPAVVSTPLTKLASQPSNEETYDDESDGVAYEAVPQSAAPAVPADLTVRNFNVTR VRSSDVLPLAKIFVDSNGGGNVVDYPGNNSLVVSGSAQVMPALSDFITSIDVAREQVLIQ SLMFETSVSNGVDLSFALALASGGKVAGGFNTSALGTALSTAGGSFGIFNGNILALSLQA VQSDSNSKVISTPRILTQSGQSGYISVGQNVPFVTGKVTGEAASVNNPFQTIERRDVGVS LKVTPVVMGNGQLVLTIDTKADSLSNQAIASDIITNQRQIQTTVQIKDGQTLLLGGLISS NQFDSDRSVPFMSKIPLIGWLFRSHSDSKDDRTMFVLLTAHVIRAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | IV |
Synonyms | IV; Virion export protein; Gene 4 protein; G4P |
UniProt ID | P15420 |
◆ Recombinant Proteins | ||
Ostf1-4620M | Recombinant Mouse Ostf1 Protein, Myc/DDK-tagged | +Inquiry |
RPS3-7788M | Recombinant Mouse RPS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spike-355V | Recombinant 2019-nCoV Spike RBD(G446S) Protein, His-tagged | +Inquiry |
NUDT21-5051C | Recombinant Chicken NUDT21 | +Inquiry |
Rsph6a-5636M | Recombinant Mouse Rsph6a Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ppk-8320P | Native Propionibacterium shermanii ppk | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
IgA-246H | Native Hamster Immunoglobulin A | +Inquiry |
Collagen Type I-10G | Native Goat Collagen Type I Protein | +Inquiry |
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF192-1993HCL | Recombinant Human ZNF192 cell lysate | +Inquiry |
PSCA-2791HCL | Recombinant Human PSCA 293 Cell Lysate | +Inquiry |
PARP8-1285HCL | Recombinant Human PARP8 cell lysate | +Inquiry |
HA-1453HCL | Recombinant H9N2 HA cell lysate | +Inquiry |
Stomach-124M | Mouse Stomach Tissue Lysate (14 Day Old) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IV Products
Required fields are marked with *
My Review for All IV Products
Required fields are marked with *
0
Inquiry Basket