Recombinant Full Length Escherichia Coli Signal Transduction Histidine-Protein Kinase Atos(Atos) Protein, His-Tagged
Cat.No. : | RFL25156EF |
Product Overview : | Recombinant Full Length Escherichia coli Signal transduction histidine-protein kinase AtoS(atoS) Protein (Q06067) (1-608aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-608) |
Form : | Lyophilized powder |
AA Sequence : | MHYMKWIYPRRLRNQMILMAILMVIVPTLTIGYIVETEGRSAVLSEKEKKLSAVVNLLNQ ALGDRYDLYIDLPREERIRALNAELAPITENITHAFPGIGAGYYNKMLDAIITYAPSALY QNNVGVTIAADHPGREVMRTNTPLVYSGRQVRGDILNSMLPIERNGEILGYIWANELTED IRRQAWKMDVRIIIVLTAGLLISLLLIVLFSRRLSANIDIITDGLSTLAQNIPTRLPQLP GEMGQISQSVNNLAQALRETRTLNDLIIENAADGVIAIDRQGDVTTMNPAAEVITGYQRH ELVGQPYSMLFDNTQFYSPVLDTLEHGTEHVALEISFPGRDRTIELSVTTSRIHNTHGEM IGALVIFSDLTARKETQRRMAQAERLATLGELMAGVAHEVRNPLTAIRGYVQILRQQTSD PIHQEYLSVVLKEIDSINKVIQQLLEFSRPRHSQWQQVSLNALVEETLVLVQTAGVQARV DFISELDNELSPINADRELLKQVLLNILINAVQAISARGKIRIQTWQYSDSQQAISIEDN GCGIDLSLQKKIFDPFFTTKASGTGLGLALSQRIINAHQGDIRVASLPGYGATFTLILPI NPQGNQTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atoS |
Synonyms | atoS; b2219; JW2213; Signal transduction histidine-protein kinase AtoS |
UniProt ID | Q06067 |
◆ Recombinant Proteins | ||
ACVR2B-3386C | Active Recombinant Cynomolgus ACVR2B protein(Ser28-Thr143), His-tagged | +Inquiry |
TAS2R107-5597R | Recombinant Rat TAS2R107 Protein, His (Fc)-Avi-tagged | +Inquiry |
SULT1A3-4558R | Recombinant Rhesus monkey SULT1A3 Protein, His-tagged | +Inquiry |
PPT1-3581R | Recombinant Rhesus monkey PPT1 Protein, His-tagged | +Inquiry |
Rufy4-5649M | Recombinant Mouse Rufy4 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
GAPDH-126R | Active Native Rabbit GAPDH | +Inquiry |
Lectin-1858V | Active Native Vicia Villosa Lectin Protein | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
C3-01R | Native Rabbit C3 Protein | +Inquiry |
S100A14-394H | Native Human S100A14 protein(Gly2-His104), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
ZNF74-2083HCL | Recombinant Human ZNF74 cell lysate | +Inquiry |
KRBA2-997HCL | Recombinant Human KRBA2 cell lysate | +Inquiry |
TRIM14-1821HCL | Recombinant Human TRIM14 cell lysate | +Inquiry |
RNF11-2310HCL | Recombinant Human RNF11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All atoS Products
Required fields are marked with *
My Review for All atoS Products
Required fields are marked with *
0
Inquiry Basket