Recombinant Full Length Escherichia Coli Sensor Kinase Cuss(Cuss) Protein, His-Tagged
Cat.No. : | RFL35106EF |
Product Overview : | Recombinant Full Length Escherichia coli Sensor kinase CusS(cusS) Protein (P77485) (1-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-480) |
Form : | Lyophilized powder |
AA Sequence : | MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER VLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGAPDIREFTRDAIPDKDA QGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL RFVGDKCQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTVDHLVQVIVENPGTPIA PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDARGTRFVITLPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cusS |
Synonyms | cusS; ybcZ; b0570; JW5082; Sensor histidine kinase CusS |
UniProt ID | P77485 |
◆ Recombinant Proteins | ||
HAVCR2-738M | Recombinant Mouse HAVCR2 Protein | +Inquiry |
AURKA-47HFL | Recombinant Full Length Human AURKA Protein, C-Flag-tagged | +Inquiry |
CDKN1A-30053TH | Recombinant Human CDKN1A | +Inquiry |
DICER1-762H | Recombinant Human DICER1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALAS1-2179C | Recombinant Chicken ALAS1 | +Inquiry |
◆ Native Proteins | ||
CKMB-165H | Active Native Human Creatine Kinase MB | +Inquiry |
Collagen Type I-05H | Native Human Collagen Type I | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
Hp-134M | Native Mouse Haptoglobin | +Inquiry |
Fga -67R | Native Rat Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGO2-576MCL | Recombinant Mouse AGO2 cell lysate | +Inquiry |
SNAP29-1652HCL | Recombinant Human SNAP29 cell lysate | +Inquiry |
CD59-1019CCL | Recombinant Cynomolgus CD59 cell lysate | +Inquiry |
GTF2IRD2-764HCL | Recombinant Human GTF2IRD2 cell lysate | +Inquiry |
ICOSLG-2804MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cusS Products
Required fields are marked with *
My Review for All cusS Products
Required fields are marked with *
0
Inquiry Basket