Recombinant Full Length Escherichia Coli Regulator Of Sigma E Protease(Rsep) Protein, His-Tagged
Cat.No. : | RFL13729EF |
Product Overview : | Recombinant Full Length Escherichia coli Regulator of sigma E protease(rseP) Protein (P0AEH1) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYV IALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVF IIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWDAVRLQLVDKIGDESTTI TVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIG FVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSG PISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPVLDGGHLLFLAIEKIKGGPVS ERVQDFCYRIGSILLVLLMGLALFNDFSRL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rseP |
Synonyms | rseP; ecfE; yaeL; b0176; JW0171; Regulator of sigma-E protease RseP; S2P endopeptidase; Site-2 protease RseP; S2P protease RseP; Site-2-type intramembrane protease |
UniProt ID | P0AEH1 |
◆ Native Proteins | ||
CTSD-27858TH | Native Human CTSD | +Inquiry |
PRSS7-42P | Native Porcine Enterokinase | +Inquiry |
GG-189S | Native Sheep Gamma Globulin protein | +Inquiry |
Avidin-015 | Native Avidin Protein, Peroxidase conjugated | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNTB2-1657HCL | Recombinant Human SNTB2 cell lysate | +Inquiry |
ERBB2-1727MCL | Recombinant Mouse ERBB2 cell lysate | +Inquiry |
Stomach-Fundus-498C | Cynomolgus monkey Stomach-Fundus Lysate | +Inquiry |
ZNF766-2085HCL | Recombinant Human ZNF766 cell lysate | +Inquiry |
HTRA4-5328HCL | Recombinant Human HTRA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All rseP Products
Required fields are marked with *
My Review for All rseP Products
Required fields are marked with *
0
Inquiry Basket