Recombinant Full Length Escherichia Coli Putative Ferric Transport System Permease Protein Fbpb(Fbpb) Protein, His-Tagged
Cat.No. : | RFL7355EF |
Product Overview : | Recombinant Full Length Escherichia coli Putative ferric transport system permease protein fbpB(fbpB) Protein (P75681) (1-115aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-115) |
Form : | Lyophilized powder |
AA Sequence : | GQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDT RVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFIFDWLIGESRTSRSKAKNQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | afuB |
Synonyms | afuB; fbpB; b0263; JW0255; Putative ferric transport system permease-like protein AfuB |
UniProt ID | P75681 |
◆ Recombinant Proteins | ||
FGF6-176H | Recombinant Human Fibroblast Growth Factor 6 | +Inquiry |
CTSL-120H | Recombinant Human CTSL Protein, His-tagged | +Inquiry |
CUEDC2-1336R | Recombinant Rat CUEDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GOLM1-3544H | Recombinant Human GOLM1 Protein (Ser35-Leu400), His tagged | +Inquiry |
LOXL1-149H | Recombinant Human LOXL1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALPI-8348B | Native Bovine ALPI | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
LH-838H | Active Native Human Luteinizing Hormone | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
POGZ-1387HCL | Recombinant Human POGZ cell lysate | +Inquiry |
SLC28A2-1745HCL | Recombinant Human SLC28A2 293 Cell Lysate | +Inquiry |
FAM65B-6359HCL | Recombinant Human FAM65B 293 Cell Lysate | +Inquiry |
HNRNPAB-5450HCL | Recombinant Human HNRNPAB 293 Cell Lysate | +Inquiry |
MIS12-4308HCL | Recombinant Human MIS12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All afuB Products
Required fields are marked with *
My Review for All afuB Products
Required fields are marked with *
0
Inquiry Basket