Recombinant Full Length Escherichia Coli Putative Diguanylate Cyclase Yeaj(Yeaj) Protein, His-Tagged
Cat.No. : | RFL19560EF |
Product Overview : | Recombinant Full Length Escherichia coli Putative diguanylate cyclase YeaJ(yeaJ) Protein (P76237) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MKLHHRMLRHFIAASVIVLTSSFLIFELVASDRAMSAYLRYIVQKADSSFLYDKYQNQSI AAHVMRALAAEQSEVSPEQRRAICEAFESANNTHGLNLTAHKYPGLRGTLQTASTDCDTI VEAAALLPAFDQAVEGNRHQDDYGSGLGMAEEKFHYYLDLNDRYVYFYEPVNVEYFAMNN WSFLQSGSIGIDRKDIEKVFTGRTVLSSIYQDQRTKQNVMSLLTPVYVAGQLKGIVLLDI NKNNLRNIFYTHDRPLLWRFLNVTLTDTDSGRDIIINQSEDNLFQYVSYVHDLPGGIRVS LSIDILYFITSSWKSVLFWILTALILLNMVRMHFRLYQNVSRENISDAMTGLYNRKILTP ELEQRLQKLVQSGSSVMFIAIDMDKLKQINDTLGHQEGDLAITLLAQAIKQSIRKSDYAI RLGGDEFCIILVDSTPQIAAQLPERIEKRLQHIAPQKEIGFSSGIYAMKENDTLHDAYKA SDERLYVNKQNKNSRS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcJ |
Synonyms | dgcJ; yeaJ; b1786; JW5291; Probable diguanylate cyclase DgcJ; DGC |
UniProt ID | P76237 |
◆ Native Proteins | ||
HPX-206H | Native Human Native Human HPX | +Inquiry |
TF-135R | Native Rabbit Transferrin | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
Lectin-1727W | Native Wheat Germ Lectin, Biotin conjugated | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-329C | Cynomolgus monkey Lung: Trachea Lysate | +Inquiry |
C17orf28-8240HCL | Recombinant Human C17orf28 293 Cell Lysate | +Inquiry |
FANCI-627HCL | Recombinant Human FANCI cell lysate | +Inquiry |
CELF5-184HCL | Recombinant Human CELF5 cell lysate | +Inquiry |
SSTR2-1452HCL | Recombinant Human SSTR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcJ Products
Required fields are marked with *
My Review for All dgcJ Products
Required fields are marked with *
0
Inquiry Basket