Recombinant Full Length Escherichia Coli Putative Colanic Biosynthesis Udp-Glucose Lipid Carrier Transferase(Wcaj) Protein, His-Tagged
Cat.No. : | RFL36160EF |
Product Overview : | Recombinant Full Length Escherichia coli Putative colanic biosynthesis UDP-glucose lipid carrier transferase(wcaJ) Protein (P71241) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MTNLKKRERAKTNASLISMVQRFSDITIMFAGLWLVCEVSGLSFLYMHLLVALITLVVFQ MLGGITDFYRSWRGVRAATEFALLLQNWTLSVIFSAGLVAFNNDFDTQLKIWLAWYALTS IGLVVCRSCIRIGAGWLRNHGYNKRMVAVAGDLAAGQMLMESFRNQPWLGFEVVGVYHDP KPGGVSNDWAGNLQQLVEDAKAGKIHNVYIAMQMCDGARVKKLVHQLADTTCSVLLIPDV FTFNILHSRLEEMNGVPVVPLYDTPLSGVNRLLKRAEDIVLATLILLLISPVLCCIALAV KLSSPGPVIFRQTRYGMDGKPIKVWKFRSMKVMENDKVVTQATQNDPRVTKVGNFLRRTS LDELPQFINVLTGGMSIVGPRPHAVAHNEQYRQLIEGYMLRHKVKPGITGWAQINGWRGE TDTLEKMEKRVEFDLEYIREWSVWFDIKIVFLTVFKGFVNKAAY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | wcaJ |
Synonyms | wcaJ; b2047; JW2032; UDP-glucose:undecaprenyl-phosphate glucose-1-phosphate transferase; UDP-Glc:Und-P Glc-1-P transferase; Colanic acid biosynthesis UDP-glucose lipid carrier transferase; Glucosyl-P-P-undecaprenol synthase |
UniProt ID | P71241 |
◆ Recombinant Proteins | ||
RFL8495PF | Recombinant Full Length Pseudomonas Syringae Pv. Syringae Upf0114 Protein Psyr_4257(Psyr_4257) Protein, His-Tagged | +Inquiry |
S-416S | Active Recombinant SARS-CoV-2 Spike RBD (T478K) Protein, His-tagged | +Inquiry |
PHYKPL-3548Z | Recombinant Zebrafish PHYKPL | +Inquiry |
NFE2L2-30414TH | Recombinant Human NFE2L2 | +Inquiry |
ADCK5-98H | Recombinant Human ADCK5, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
LTF-3211B | Native Bovine Lactoferrin Protein | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
IgG-348G | Native Hamster Gamma Globulin Fraction | +Inquiry |
a-acid glycoprotein-003H | Native Human a-acid glycoprotein Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM4-776HCL | Recombinant Human TRIM4 293 Cell Lysate | +Inquiry |
TBC1D9B-653HCL | Recombinant Human TBC1D9B lysate | +Inquiry |
CLDND1-7456HCL | Recombinant Human CLDND1 293 Cell Lysate | +Inquiry |
HPS4-5395HCL | Recombinant Human HPS4 293 Cell Lysate | +Inquiry |
TPP1-449HCL | Recombinant Human TPP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All wcaJ Products
Required fields are marked with *
My Review for All wcaJ Products
Required fields are marked with *
0
Inquiry Basket