Recombinant Full Length Escherichia Coli Protein Transport Protein Hofc Homolog(Hofc) Protein, His-Tagged
Cat.No. : | RFL3970EF |
Product Overview : | Recombinant Full Length Escherichia coli Protein transport protein HofC homolog(hofC) Protein (P36646) (1-400aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-400) |
Form : | Lyophilized powder |
AA Sequence : | MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSLKRIAINSAQWRGDKS AEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDLEQGIAFSNALLPWSEV FPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSALRYPIIILAMAIMVVVAM LHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVLFGFLLAIANKLLMRRPTW LIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFLQGVESVRETMRCPYWVQLL TQIQHDISNGQPIWLALKNTGEFSPLCLQLVRTGEASGSLDLMLDNLAHHHRENTMALAD NLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGMG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hofC |
Synonyms | hofC; hopC; yacD; b0106; JW0102; Protein transport protein HofC homolog |
UniProt ID | P36646 |
◆ Native Proteins | ||
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
Fgb-64R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
Plasmin-251H | Active Native Human Plasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSPY3-701HCL | Recombinant Human TSPY3 293 Cell Lysate | +Inquiry |
MAGEB4-4543HCL | Recombinant Human MAGEB4 293 Cell Lysate | +Inquiry |
SLBP-596HCL | Recombinant Human SLBP lysate | +Inquiry |
RAB2A-2611HCL | Recombinant Human RAB2A 293 Cell Lysate | +Inquiry |
FDFT1-6271HCL | Recombinant Human FDFT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All hofC Products
Required fields are marked with *
My Review for All hofC Products
Required fields are marked with *
0
Inquiry Basket