Recombinant Full Length Escherichia Coli Protein Damx(Damx) Protein, His-Tagged
Cat.No. : | RFL21370EF |
Product Overview : | Recombinant Full Length Escherichia coli Protein damX(damX) Protein (P11557) (1-428aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-428) |
Form : | Lyophilized powder |
AA Sequence : | MDEFKPEDELKPDPSDRRTGRSRQSSERSERTERGEPQINFDDIELDDTDDRRPTRAQKE RNEEPEIEEEIDESEDETVDEERVERRPRKRKKAASKPASRQYMMMGVGILVLLLLIIGI GSALKAPSTTSSDQTASGEKSIDLAGNATDQANGVQPAPGTTSAENTQQDVSLPPISSTP TQGQTPVATDGQQRVEVQGDLNNALTQPQNQQQLNNVAVNSTLPTEPATVAPVRNGNASR DTAKTQTAERPSTTRPARQQAVIEPKKPQATVKTEPKPVAQTPKRTEPAAPVASTKAPAA TSTPAPKETATTAPVQTASPAQTTATPAAGAKTAGNVGSLKSAPSSHYTLQLSSSSNYDN LNGWAKKENLKNYVVYETTRNGQPWYVLVSGVYASKEEAKKAVSTLPADVQAKNPWAKPL RQVQADLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | damX |
Synonyms | damX; yhfB; b3388; JW3351; Cell division protein DamX |
UniProt ID | P11557 |
◆ Native Proteins | ||
PLF4-88H | Active Native Human PF 4 | +Inquiry |
TSH-25H | Active Native Human Thyroid Stimulating Hormone protein | +Inquiry |
Lectin-1745S | Active Native Sambucus Nigra Lectin Protein | +Inquiry |
Laminin-33H | Native Human Laminin protein | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTC4-674HCL | Recombinant Human TTC4 293 Cell Lysate | +Inquiry |
KHDRBS2-4987HCL | Recombinant Human KHDRBS2 293 Cell Lysate | +Inquiry |
TIMD4-2465MCL | Recombinant Mouse TIMD4 cell lysate | +Inquiry |
SIX1-1825HCL | Recombinant Human SIX1 293 Cell Lysate | +Inquiry |
AIMP2-8951HCL | Recombinant Human AIMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All damX Products
Required fields are marked with *
My Review for All damX Products
Required fields are marked with *
0
Inquiry Basket