Recombinant Full Length Escherichia Coli Protein Aaex(Aaex) Protein, His-Tagged
Cat.No. : | RFL25599EF |
Product Overview : | Recombinant Full Length Escherichia coli Protein AaeX(aaeX) Protein (Q1R697) (1-67aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-67) |
Form : | Lyophilized powder |
AA Sequence : | MSLFPVIVVFGLSFPPIFFELLLSLAIFWLVRRVLVPTGIYDFVWHPALFNTALYCCLFY LISRLFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aaeX |
Synonyms | aaeX; UTI89_C3673; Protein AaeX |
UniProt ID | Q1R697 |
◆ Recombinant Proteins | ||
ERAP2-4356HF | Recombinant Full Length Human ERAP2 Protein, GST-tagged | +Inquiry |
GABRA2-5183HF | Recombinant Full Length Human GABRA2 Protein | +Inquiry |
Gsn-532M | Recombinant Mouse Gsn Protein, His-tagged | +Inquiry |
RFL26427CF | Recombinant Full Length Chlamydia Trachomatis Uncharacterized Protein Ct_006 (Ct_006) Protein, His-Tagged | +Inquiry |
LASP1-278HF | Recombinant Full Length Human LASP1 Protein | +Inquiry |
◆ Native Proteins | ||
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
LDL-245H | Native Human Lipoproteins, Low Density | +Inquiry |
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDB2-4791HCL | Recombinant Human LDB2 293 Cell Lysate | +Inquiry |
CD37-7677HCL | Recombinant Human CD37 293 Cell Lysate | +Inquiry |
C9orf3-7933HCL | Recombinant Human C9orf3 293 Cell Lysate | +Inquiry |
DAK-2112HCL | Recombinant Human DAK cell lysate | +Inquiry |
TMSB10-906HCL | Recombinant Human TMSB10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aaeX Products
Required fields are marked with *
My Review for All aaeX Products
Required fields are marked with *
0
Inquiry Basket