Recombinant Full Length Escherichia Coli Probable Diguanylate Cyclase Adra(Adra) Protein, His-Tagged
Cat.No. : | RFL31478EF |
Product Overview : | Recombinant Full Length Escherichia coli Probable diguanylate cyclase AdrA(adrA) Protein (P0AAP1) (1-371aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-371) |
Form : | Lyophilized powder |
AA Sequence : | MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPRAVGLAGMFLPIASTL VSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNV LPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGITVSFNSAPLEWWLSLPI IVIYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRRHWETMLRNEFDNCRRHNR DATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRGSDVIGRFGGDEFAVIMSGT PAESAITAMLRVHEGLNTLRLPNTPQVTLRISVGVAPLNPQMSHYREWLKSADLALYKAK KAGRNRTEVAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dgcC |
Synonyms | dgcC; adrA; yaiC; b0385; JW0376; Probable diguanylate cyclase DgcC; DGC |
UniProt ID | P0AAP1 |
◆ Recombinant Proteins | ||
SH3BP2-4533H | Recombinant Human SH3BP2 protein, His-tagged | +Inquiry |
CD1A-24H | Recombinant Human CD1A protein, His-tagged | +Inquiry |
COL27A1-1177R | Recombinant Rat COL27A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MESDC1-5481M | Recombinant Mouse MESDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM78A-1452R | Recombinant Rhesus Macaque FAM78A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
TSH-1312B | Active Native Bovine TSH Protein | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
B. garinii-22 | Native Borrelia garinii Antigen | +Inquiry |
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRI3-67HCL | Recombinant Human BRI3 lysate | +Inquiry |
REN-2576MCL | Recombinant Mouse REN cell lysate | +Inquiry |
SSR3-1458HCL | Recombinant Human SSR3 293 Cell Lysate | +Inquiry |
WRB-282HCL | Recombinant Human WRB 293 Cell Lysate | +Inquiry |
PARP1-514MCL | Recombinant Mouse PARP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dgcC Products
Required fields are marked with *
My Review for All dgcC Products
Required fields are marked with *
0
Inquiry Basket