Recombinant Full Length Escherichia Coli O9:H4 Upf0299 Membrane Protein Yohj(Yohj) Protein, His-Tagged
Cat.No. : | RFL5083EF |
Product Overview : | Recombinant Full Length Escherichia coli O9:H4 UPF0299 membrane protein yohJ(yohJ) Protein (A8A203) (1-132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-132) |
Form : | Lyophilized powder |
AA Sequence : | MSKTLNIIWQYLRAFVLIYACLYAGIFIASLLPVTIPGSIIGMLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAVSTLVVFLVVSWSSQLVHG ERKVVGQKGSEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yohJ |
Synonyms | yohJ; EcHS_A2275; UPF0299 membrane protein YohJ |
UniProt ID | A8A203 |
◆ Recombinant Proteins | ||
RFL20651MF | Recombinant Full Length Mouse Egf-Like Module-Containing Mucin-Like Hormone Receptor-Like 4(Emr4) Protein, His-Tagged | +Inquiry |
REM1-11391Z | Recombinant Zebrafish REM1 | +Inquiry |
DEPTOR-957HFL | Recombinant Full Length Human DEPTOR Protein, C-Flag-tagged | +Inquiry |
ADCK1-333M | Recombinant Mouse ADCK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED4-5460M | Recombinant Mouse MED4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
SAA-152H | Native Human Serum Amyloid A Protein | +Inquiry |
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHOSPHO1-3217HCL | Recombinant Human PHOSPHO1 293 Cell Lysate | +Inquiry |
UVRAG-444HCL | Recombinant Human UVRAG 293 Cell Lysate | +Inquiry |
TSR2-697HCL | Recombinant Human TSR2 293 Cell Lysate | +Inquiry |
SRSF12-1905HCL | Recombinant Human SFRS13B 293 Cell Lysate | +Inquiry |
TTC18-1854HCL | Recombinant Human TTC18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yohJ Products
Required fields are marked with *
My Review for All yohJ Products
Required fields are marked with *
0
Inquiry Basket