Recombinant Full Length Escherichia Coli O81 Universal Stress Protein B(Uspb) Protein, His-Tagged
Cat.No. : | RFL21283EF |
Product Overview : | Recombinant Full Length Escherichia coli O81 Universal stress protein B(uspB) Protein (B7N1S8) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uspB |
Synonyms | uspB; ECED1_4163; Universal stress protein B |
UniProt ID | B7N1S8 |
◆ Recombinant Proteins | ||
RFL33132MF | Recombinant Full Length Macaca Fascicularis Zinc Transporter Zip9(Slc39A9) Protein, His-Tagged | +Inquiry |
ANXA10-118 | Recombinant Annexin A10 | +Inquiry |
COX5A-1914M | Recombinant Mouse COX5A Protein, His (Fc)-Avi-tagged | +Inquiry |
Tpsab1-1460M | Recombinant Mouse Tpsab1 protein, His-tagged | +Inquiry |
EXOC7-2899M | Recombinant Mouse EXOC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1780G | Active Native Griffonia Simplicifolia Lectin I Protein, Fluorescein labeled | +Inquiry |
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
Spinal cord-C57M | Mouse Spinal cord whole Lysate, Total Protein | +Inquiry |
pepsin -173P | Native Pig pepsin | +Inquiry |
a-Actinin-20C | Native Chicken a-Actinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
POLM-3043HCL | Recombinant Human POLM 293 Cell Lysate | +Inquiry |
PPP4R4-2910HCL | Recombinant Human PPP4R4 293 Cell Lysate | +Inquiry |
KPNA6-4887HCL | Recombinant Human KPNA6 293 Cell Lysate | +Inquiry |
HSF2BP-5365HCL | Recombinant Human HSF2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uspB Products
Required fields are marked with *
My Review for All uspB Products
Required fields are marked with *
0
Inquiry Basket