Recombinant Full Length Escherichia Coli O7:K1 Bifunctional Protein Aas(Aas) Protein, His-Tagged
Cat.No. : | RFL30991EF |
Product Overview : | Recombinant Full Length Escherichia coli O7:K1 Bifunctional protein aas(aas) Protein (B7NVY2) (1-719aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-719) |
Form : | Lyophilized powder |
AA Sequence : | MLFSFFRNLCRVLYRVRVTGDNQALKGERVLITPNHVSFIDGILLALFLPVRPVFAVYTS ISQQWYMRWLKSFIDFVPLDPTQPMAIKHLVRLVEQGRPVVIFPEGRITTTGSLMKIYDG AGFVAAKSGATVIPVRIEGAELTHFSRLKGLVKRRLFPQITLHILPPTQVQMPDAPRARD RRKIAGEMLHQIMMEARMAVRPRETLYESLLSAMYRFGAGKKCVEDVNFTPDSYRKLLTK TLFVGRILEKYSVEGERIGLMLPNAGISAAVIFGAIARRRIPAMMNYTAGVKGLTSAITA AEIKTIFTSRQFLDKGKLWHLPEQLTQVRWVYLEDLKADVTTADKVWIFAHLLMPRLAQV KQQPEEEALILFTSGSEGHPKGVVHSHKSILANVEQIKTIADFTTNDRFMSALPLFHSFG LTVGLFTPLLTGAEVFLYPSPLHYRIVPELVYDRSCTVLFGSSTFLGHYARFANPYDFYR LRYVVAGAEKLQESTKQLWQDKFGLRILEGYGVTECAPVVSINVPMAAKPGTVGRILPGM DARLLSVPGIEEGGRLQLKGPNIMNGYLRVEKPGVLEVPTAENVRGEMERGWYDTGDIVR FDEQGFVQIQGRAKRFAKIAGEMVSLEMVEQLALGVSPDKVHATAIKSDASKGEALVLFT TDNELTRDKLQQYAREHGVPELAVPRDIRYLKQMPLLGSGKPDFVTLKSWVDEAEQHDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | aas |
Synonyms | aas; ECIAI39_3256; Bifunctional protein Aas [Includes: 2-acylglycerophosphoethanolamine acyltransferase; 2-acyl-GPE acyltransferase; Acyl-[acyl-carrier-protein]--phospholipid O-acyltransferase; Acyl-[acyl-carrier-protein] synthetase; Acyl-ACP synthetase; |
UniProt ID | B7NVY2 |
◆ Recombinant Proteins | ||
GNG12-1902R | Recombinant Rhesus monkey GNG12 Protein, His-tagged | +Inquiry |
ATG2B-9973H | Recombinant Human ATG2B, GST-tagged | +Inquiry |
ERBB2-176HF | Recombinant Human ERBB2 Protein, His/GST-tagged, FITC conjugated | +Inquiry |
ANTXR2-1516HF | Recombinant Full Length Human ANTXR2 Protein, GST-tagged | +Inquiry |
YWHAB-1170C | Recombinant Cynomolgus YWHAB protein(Met2-Asn244) | +Inquiry |
◆ Native Proteins | ||
Lectin-1736C | Active Native Canavalia ensiformis Concanavalin A Protein, Rhodamine labeled | +Inquiry |
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
TFRC-16H | Native Human Apotransferrin Protein | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPIN2A-1514HCL | Recombinant Human SPIN2A 293 Cell Lysate | +Inquiry |
Heart-538E | Equine Heart Lysate, Total Protein | +Inquiry |
GNRHR-5837HCL | Recombinant Human GNRHR 293 Cell Lysate | +Inquiry |
IL1F10-5241HCL | Recombinant Human IL1F10 293 Cell Lysate | +Inquiry |
NEUROG1-3865HCL | Recombinant Human NEUROG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All aas Products
Required fields are marked with *
My Review for All aas Products
Required fields are marked with *
0
Inquiry Basket