Recombinant Full Length Escherichia Coli O6:K15:H31 Universal Stress Protein B(Uspb) Protein, His-Tagged
Cat.No. : | RFL28569EF |
Product Overview : | Recombinant Full Length Escherichia coli O6:K15:H31 Universal stress protein B(uspB) Protein (Q0TBW9) (1-111aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-111) |
Form : | Lyophilized powder |
AA Sequence : | MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uspB |
Synonyms | uspB; ECP_3584; Universal stress protein B |
UniProt ID | Q0TBW9 |
◆ Native Proteins | ||
F10-302R | Native Rat Factor X | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
GALT-10 | Active Native Streptoverticillium mobaraense | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAQR8-3437HCL | Recombinant Human PAQR8 293 Cell Lysate | +Inquiry |
BRSK2-8403HCL | Recombinant Human BRSK2 293 Cell Lysate | +Inquiry |
NOL6-1202HCL | Recombinant Human NOL6 cell lysate | +Inquiry |
TAF6-1267HCL | Recombinant Human TAF6 293 Cell Lysate | +Inquiry |
TLR7-1043HCL | Recombinant Human TLR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uspB Products
Required fields are marked with *
My Review for All uspB Products
Required fields are marked with *
0
Inquiry Basket