Recombinant Full Length Escherichia Coli O17:K52:H18 Upf0761 Membrane Protein Yihy(Yihy) Protein, His-Tagged
Cat.No. : | RFL30141EF |
Product Overview : | Recombinant Full Length Escherichia coli O17:K52:H18 UPF0761 membrane protein yihY(yihY) Protein (B7NFI5) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yihY |
Synonyms | yihY; ECUMN_4413; UPF0761 membrane protein YihY |
UniProt ID | B7NFI5 |
◆ Recombinant Proteins | ||
RFL26484MF | Recombinant Full Length Mouse Tumor Necrosis Factor Receptor Superfamily Member 1B(Tnfrsf1B) Protein, His-Tagged | +Inquiry |
HYKK-5217H | Recombinant Human HYKK Protein, GST-tagged | +Inquiry |
PINX1-617H | Recombinant Human PINX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLF-209H | Recombinant Human HLF protein, T7/His-tagged | +Inquiry |
MPZL3-12385Z | Recombinant Zebrafish MPZL3 | +Inquiry |
◆ Native Proteins | ||
IgG Fc-07H | Native Human Immunoglobulin G Fc (IgG Fc) | +Inquiry |
CA2-29D | Native Dog Carbonic Anhydrase II (CA2) Protein | +Inquiry |
ELANE-8236H | Native Human Neutrophil Elastase (ELA-2) | +Inquiry |
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RUNX1-2112HCL | Recombinant Human RUNX1 293 Cell Lysate | +Inquiry |
Thymus-479C | Cat Thymus Lysate, Total Protein | +Inquiry |
SMOX-1656HCL | Recombinant Human SMOX 293 Cell Lysate | +Inquiry |
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
SGCA-1890HCL | Recombinant Human SGCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yihY Products
Required fields are marked with *
My Review for All yihY Products
Required fields are marked with *
0
Inquiry Basket