Recombinant Full Length Escherichia Coli Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL2010EF |
Product Overview : | Recombinant Full Length Escherichia coli NADH-quinone oxidoreductase subunit K(nuoK) Protein (B6I7M9) (1-100aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-100) |
Form : | Lyophilized powder |
AA Sequence : | MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; ECSE_2536; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | B6I7M9 |
◆ Recombinant Proteins | ||
KITLG-21H | Active Recombinant Human KITLG, HIgG1 Fc-tagged, mutant | +Inquiry |
RFL5751MF | Recombinant Full Length Mouse Olfactory Receptor 498(Olfr498) Protein, His-Tagged | +Inquiry |
MYLK-7009C | Recombinant Chicken MYLK | +Inquiry |
EOGT-5227M | Recombinant Mouse EOGT Protein | +Inquiry |
CPN1-1225R | Recombinant Rat CPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-148H | Native Human IgG Fab fragment | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP28-1895HCL | Recombinant Human USP28 cell lysate | +Inquiry |
HHLA3-5568HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
RPS26-562HCL | Recombinant Human RPS26 lysate | +Inquiry |
ATP6V1C1-8582HCL | Recombinant Human ATP6V1C1 293 Cell Lysate | +Inquiry |
CSNK1A1-617HCL | Recombinant Human CSNK1A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket