Recombinant Full Length Brucella Suis Nadh-Quinone Oxidoreductase Subunit K(Nuok) Protein, His-Tagged
Cat.No. : | RFL3979BF |
Product Overview : | Recombinant Full Length Brucella suis NADH-quinone oxidoreductase subunit K(nuoK) Protein (B0CLD9) (1-102aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-102) |
Form : | Lyophilized powder |
AA Sequence : | MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nuoK |
Synonyms | nuoK; BSUIS_A0851; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K |
UniProt ID | B0CLD9 |
◆ Recombinant Proteins | ||
TRIAP1-105H | Recombinant Human TRIAP1 protein | +Inquiry |
YKRA-1192B | Recombinant Bacillus subtilis YKRA protein, His-tagged | +Inquiry |
Styk1-6213M | Recombinant Mouse Styk1 Protein, Myc/DDK-tagged | +Inquiry |
FABP5-4245H | Recombinant Human FABP5 protein, His-tagged | +Inquiry |
ATP5SL-538R | Recombinant Rat ATP5SL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PLD-18A | Active Native Arachis hypogaea (peanut) Phospholipase D, Type II | +Inquiry |
CP-26450TH | Native Human CP | +Inquiry |
MMP9-9810 | Active Native Human MMP9 | +Inquiry |
Tropomyosin-894R | Native Rabbit Tropomyosin Protein | +Inquiry |
Chitosan-004C | Native Crawfish Chitosan Film | +Inquiry |
◆ Cell & Tissue Lysates | ||
GGN-700HCL | Recombinant Human GGN cell lysate | +Inquiry |
PDIA4-1285HCL | Recombinant Human PDIA4 cell lysate | +Inquiry |
H293-01HL | Human 293, Transformed Primary Embryonal Kidney lysate | +Inquiry |
Vagina Lupus-560H | Human Vagina Lupus Lysate | +Inquiry |
NDFIP1-3935HCL | Recombinant Human NDFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nuoK Products
Required fields are marked with *
My Review for All nuoK Products
Required fields are marked with *
0
Inquiry Basket