Recombinant Full Length Escherichia Coli Multidrug Resistance-Like Atp-Binding Protein Mdla(Mdla) Protein, His-Tagged
Cat.No. : | RFL23416EF |
Product Overview : | Recombinant Full Length Escherichia coli Multidrug resistance-like ATP-binding protein MdlA(mdlA) Protein (P77265) (1-590aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-590) |
Form : | Lyophilized powder |
AA Sequence : | MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDGVTEQHFTTGQILMWI ATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQHPEFYLRHRTGDLMARA TNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLFSLLPMPVMAIMIKRNGD ALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSALFAADAEDTGKKNMRVARI DARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFMMYLGLMIWPMLALAWMFNI VERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIHQFTYPQTDHPALENVNFALK PGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIPLTKLQLDSWRSRLAVVSQTPF LFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRLPQGYDTEVGERGVMLSGGQKQR ISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQWGQGRTVIISAHRLSALTEASEI IVMQHGHIAQRGNHDVLAQQSGWYRDMYRYQQLEAALDDAPENREEAVDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mdlA |
Synonyms | mdlA; mdl; b0448; JW0438; Multidrug resistance-like ATP-binding protein MdlA |
UniProt ID | P77265 |
◆ Recombinant Proteins | ||
STX7-3250H | Recombinant Human STX7 protein(Ser2-Leu238), mFc-tagged | +Inquiry |
GNL3L-5398HF | Recombinant Full Length Human GNL3L Protein, GST-tagged | +Inquiry |
COQ6-4367Z | Recombinant Zebrafish COQ6 | +Inquiry |
MTMR9-2775C | Recombinant Chicken MTMR9 | +Inquiry |
Dnajb11-2595M | Recombinant Mouse Dnajb11 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
C-type lectin like protein-042H | Native Hen C-type lectin like protein Protein, FITC conjugated | +Inquiry |
Hp2-2-196H | Native Human Haptoglobin 2-2 | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCIN-1568HCL | Recombinant Human SCIN cell lysate | +Inquiry |
HNRNPK-5443HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
AMN1-8879HCL | Recombinant Human AMN1 293 Cell Lysate | +Inquiry |
APOF-8779HCL | Recombinant Human APOF 293 Cell Lysate | +Inquiry |
SRP72-1477HCL | Recombinant Human SRP72 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mdlA Products
Required fields are marked with *
My Review for All mdlA Products
Required fields are marked with *
0
Inquiry Basket