Recombinant Full Length Escherichia Coli Lipoprotein-Releasing System Transmembrane Protein Lole(Lole) Protein, His-Tagged
Cat.No. : | RFL4660EF |
Product Overview : | Recombinant Full Length Escherichia coli Lipoprotein-releasing system transmembrane protein LolE(lolE) Protein (P75958) (2-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-414) |
Form : | Lyophilized powder |
AA Sequence : | AMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRILA VVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNPQ QEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLMQ PKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRDA GEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSGD IAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQFL SSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lolE |
Synonyms | lolE; ycfW; b1118; JW1104; Lipoprotein-releasing system transmembrane protein LolE |
UniProt ID | P75958 |
◆ Recombinant Proteins | ||
RFL17776SF | Recombinant Full Length Speothos Venaticus Cytochrome C Oxidase Subunit 2(Mt-Co2) Protein, His-Tagged | +Inquiry |
Dtnbp1-683R | Recombinant Rat Dtnbp1 Protein, His-tagged | +Inquiry |
BCL2L11-1578H | Recombinant Human BCL2-Like 11 (Apoptosis Facilitator) | +Inquiry |
RABEP2-2139H | Recombinant Human RABEP2, His-tagged | +Inquiry |
Cyp1a1-2412M | Recombinant Mouse Cyp1a1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LDHA-26867TH | Native Human LDHA | +Inquiry |
MB-236B | Native Bovine Myoglobin | +Inquiry |
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
MMP9-30035TH | Native Human MMP9 | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
THAP2-1106HCL | Recombinant Human THAP2 293 Cell Lysate | +Inquiry |
CCDC140-7778HCL | Recombinant Human CCDC140 293 Cell Lysate | +Inquiry |
HIST1H1A-5555HCL | Recombinant Human HIST1H1A 293 Cell Lysate | +Inquiry |
DOK4-6846HCL | Recombinant Human DOK4 293 Cell Lysate | +Inquiry |
ATP1B2-47HCL | Recombinant Human ATP1B2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All lolE Products
Required fields are marked with *
My Review for All lolE Products
Required fields are marked with *
0
Inquiry Basket