Recombinant Full Length Escherichia Coli Inner Membrane Protein Yiav(Yiav) Protein, His-Tagged
Cat.No. : | RFL27317EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane protein yiaV(yiaV) Protein (P37683) (16-378aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (16-378) |
Form : | Lyophilized powder |
AA Sequence : | MFKIFKIPVNKWTIPTAALGGIFIVSGLILLMNYNHPYTFKAQKAVISIPVVPQVTGVVI EVTDKKNTLIKKGEVLFRLDPTRYQARVDRLMADIVTAEHKQRALGAELDEMAANTQQAK ATRDKFAKEYQRYARGSQAKVNPFSERDIDVARQNYLAQEASVKSSAAEQKQIQSQLDSL VLGEHSQIASLKAQLAEAKYNLEQTIVRAPSDGYVTQVLIRPGTYAASLPLRPVMVFIPD QKRQIVAQFRQNSLLRLAPGDDAEVVFNALPGKVFSGKLAAISPAVPGGAYQSTGTLQTL NTAPGSDGVIATIELDEHTDLSALPDGIYAQVAVYSDHFSHVSVMRKVLLRMTSWVHYLY LDH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yiaV |
Synonyms | yiaV; b3586; JW3558; Inner membrane protein YiaV |
UniProt ID | P37683 |
◆ Recombinant Proteins | ||
CAV3-5940C | Recombinant Chicken CAV3 | +Inquiry |
TDRD5-16612M | Recombinant Mouse TDRD5 Protein | +Inquiry |
RFL30021BF | Recombinant Full Length Bacillus Subtilis Uncharacterized Protein Ywcb(Ywcb) Protein, His-Tagged | +Inquiry |
CGNL1-11150H | Recombinant Human CGNL1, His-tagged | +Inquiry |
RFL27036CF | Recombinant Full Length Atp Synthase Subunit A, Chloroplastic(Atpi) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
Lectin-1747L | Active Native Lotus Tetragonolobus Lectin Protein | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
PMPCB-284H | Native Human PMPCB, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS27L-2164HCL | Recombinant Human RPS27L 293 Cell Lysate | +Inquiry |
MYL10-1158HCL | Recombinant Human MYL10 cell lysate | +Inquiry |
DHX29-477HCL | Recombinant Human DHX29 cell lysate | +Inquiry |
Colon-99H | Human Colon Tumor Lysate | +Inquiry |
ZNF205-123HCL | Recombinant Human ZNF205 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yiaV Products
Required fields are marked with *
My Review for All yiaV Products
Required fields are marked with *
0
Inquiry Basket