Recombinant Full Length Escherichia Coli Inner Membrane Protein Yban(Yban) Protein, His-Tagged
Cat.No. : | RFL28637EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane protein ybaN(ybaN) Protein (P0AAR5) (1-125aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-125) |
Form : | Lyophilized powder |
AA Sequence : | MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPRFHAWLLYRSWFGSYL RFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVILACLLFYMWRIPVIDE KQEKH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ybaN |
Synonyms | ybaN; b0468; JW0457; Inner membrane protein YbaN |
UniProt ID | P0AAR5 |
◆ Recombinant Proteins | ||
THOC6-4519R | Recombinant Rhesus Macaque THOC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ICA1-7968M | Recombinant Mouse ICA1 Protein | +Inquiry |
PINX1-6750M | Recombinant Mouse PINX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il21-01M | Active Recombinant Mouse Il21 Protein, His-Tagged | +Inquiry |
JPH3-8432M | Recombinant Mouse JPH3 Protein | +Inquiry |
◆ Native Proteins | ||
eCG-01E | Active Native Equine Gonadotropin protein | +Inquiry |
IgA-252H | Native Human Immunoglobulin A | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
SERPINF2-27292TH | Native Human SERPINF2 | +Inquiry |
IgA-130H | Native Human Immunoglobulin A | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC9-7742HCL | Recombinant Human CCDC9 293 Cell Lysate | +Inquiry |
Rectum-412P | Porcine Rectum Lysate | +Inquiry |
Ovary-786D | Dog Ovary Membrane Lysate, Total Protein | +Inquiry |
RNF170-1521HCL | Recombinant Human RNF170 cell lysate | +Inquiry |
PTHLH-2701HCL | Recombinant Human PTHLH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ybaN Products
Required fields are marked with *
My Review for All ybaN Products
Required fields are marked with *
0
Inquiry Basket