Recombinant Full Length Escherichia Coli Inner Membrane Abc Transporter Atp-Binding Protein Ydda(Ydda) Protein, His-Tagged
Cat.No. : | RFL2911EF |
Product Overview : | Recombinant Full Length Escherichia coli Inner membrane ABC transporter ATP-binding protein YddA(yddA) Protein (P31826) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MITIPITLRMLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGVVKIQVWLNDWNNDFF NALSQKETDKLWQLVLWFPALLGIFVLISVNKTWLIKLLTIRWREWLTDYYLNRWFADKN YYFTQIYGEHKNTDNPDQRIAEDILLLISKTLSLSFGFIQSLSMLITFTVILWESAGTLS FTVGGTEWNIQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVEKQRSEATFRTNLVQHNKQ AELIALSNAESLQRQELSDNFHTIKENWHRLMNRQRWLDYWQNIYSRSLSVLPYFLLLPQ FISGQINLGGLMKSRQAFMLVSNNLSWFIYKYDELAELAAVIDRLYEFHQLTEQRPTNKP KNCQHAVQVADASIRTPDNKIILENLNFHVSPGKWLLLKGYSGAGKTTLLKTLSHCWPWF KGDISSPADSWYVSQTPLIKTGLLKEIICKALPLPVDDKSLSEVLHQVGLGKLAARIHDH DRWGDILSSGEKQRIALARLILRRPKWIFLDETTSHLEEQEAIRLLRLVREKLPTSGVIM VTHQPGVWNLADDICDISAVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yddA |
Synonyms | yddA; b1496; JW5242; Inner membrane ABC transporter ATP-binding protein YddA; CDS102 |
UniProt ID | P31826 |
◆ Native Proteins | ||
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
TSH-25H | Active Native Human Thyroid Stimulating Hormone protein | +Inquiry |
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPBTT30933GH | Goat Anti-Human Hemoglobin PAb, FITC-Conjugation | +Inquiry |
CREG1-1123MCL | Recombinant Mouse CREG1 cell lysate | +Inquiry |
RNF125-545HCL | Recombinant Human RNF125 lysate | +Inquiry |
LSM7-9170HCL | Recombinant Human LSM7 293 Cell Lysate | +Inquiry |
COMMD2-7371HCL | Recombinant Human COMMD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yddA Products
Required fields are marked with *
My Review for All yddA Products
Required fields are marked with *
0
Inquiry Basket