Recombinant Full Length Escherichia Coli Ferric Enterobactin Transport Protein Fepe(Fepe) Protein, His-Tagged
Cat.No. : | RFL4872EF |
Product Overview : | Recombinant Full Length Escherichia coli Ferric enterobactin transport protein fepE(fepE) Protein (P26266) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MSSLNIKQGSDAHFPDYPLASPSNNEIDLLNLISVLWRAKKTVMAVVFAFACAGLLISFI LPQKWTSAAVVTPPEPVQWQELEKSFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEY LRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKKDEPSLYTSWTLSFTAPT SEEAQTVLSGYIDYISTLVVKESLENVRNKLEIKTQFEKEKLAQDRIKTKNQLDANIQRL NYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERKLEIEKAVTDVAELNGELRN RQYLVEQLTKAHVNDVNFTPFKYQLSPSLPVKKDGPGKAIIVILSALIGGMVACGGVLLR YAMASRKQDAMMADHLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | fepE |
Synonyms | fepE; b0587; JW0579; Ferric enterobactin transport protein FepE |
UniProt ID | P26266 |
◆ Recombinant Proteins | ||
4-1BB-01M | Active Recombinant Mouse 4-1BB Protein, His-Tagged | +Inquiry |
Csf1r-376M | Recombinant Mouse Csf1r Protein, Fc-tagged | +Inquiry |
ATIC-503R | Recombinant Rat ATIC Protein, His (Fc)-Avi-tagged | +Inquiry |
FIBP-99H | Recombinant Human FIBP | +Inquiry |
ABCG2-187H | Recombinant Human ABCG2 Protein, C-His-tagged | +Inquiry |
◆ Native Proteins | ||
LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
LPA-8453H | Native Human LPA | +Inquiry |
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
◆ Cell & Tissue Lysates | ||
UROS-482HCL | Recombinant Human UROS 293 Cell Lysate | +Inquiry |
SCART1-1020HCL | Recombinant Human SCART1 cell lysate | +Inquiry |
SLITRK1-2847HCL | Recombinant Human SLITRK1 cell lysate | +Inquiry |
KIAA1279-001HCL | Recombinant Human KIAA1279 cell lysate | +Inquiry |
RAB19-2624HCL | Recombinant Human RAB19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fepE Products
Required fields are marked with *
My Review for All fepE Products
Required fields are marked with *
0
Inquiry Basket